BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40246 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 26 0.31 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 1.6 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.2 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 23 2.2 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 6.6 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 25.8 bits (54), Expect = 0.31 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -2 Query: 407 DQGSFQYYSPFLVSLILFSSKFIYPTQLRTTVL 309 D+G ++SPFLV+ + F + Y T + T ++ Sbjct: 390 DKGDIFWFSPFLVANLAFVTIVTYETFVWTQIM 422 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 166 NRSELISTRFTGATGRAFLFHKVVNLIYS 252 NRSELI+++ FL V +I S Sbjct: 9 NRSELITSKIVSFVNSIFLVMSAVTIILS 37 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 121 GTRLFSCASCDVNLTNRSELIS 186 G++ F C CD N+S L S Sbjct: 255 GSKPFQCNKCDYTCVNKSMLNS 276 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 121 GTRLFSCASCDVNLTNRSELIS 186 G++ F C CD N+S L S Sbjct: 13 GSKPFQCNKCDYTCVNKSMLNS 34 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 101 YFLIILEERDYFHAHHAMSILRIV 172 YF I ++ HH+ SI R + Sbjct: 136 YFHIATTSNEFIRVHHSGSITRSI 159 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,911 Number of Sequences: 336 Number of extensions: 2552 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -