BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40246 (645 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr... 46 5e-06 SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|ch... 27 3.1 SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharom... 26 5.3 >SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 131 Score = 46.0 bits (104), Expect = 5e-06 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +3 Query: 270 MLTGRHMVRDVSCKNCGTKLGWVYEFATEENQRYKEGRVILE 395 M TGR +VR + C C T +GW Y + E +Q++K+G ILE Sbjct: 60 MSTGRFIVRHIHCCRCHTYIGWKYVSSYEPSQKFKDGHYILE 101 >SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 764 Score = 26.6 bits (56), Expect = 3.1 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +1 Query: 151 DVNLTNRSELIS---TRFTGATGRAFLFHKVVNLIYSEFRIV*C*QDVTWCVMF 303 D +L + SE+ S T +TG+ L VVNL S + C D TW + F Sbjct: 410 DTSLLSVSEVTSHPPTEWTGSPLAHVLCSDVVNLSVSTVFNLLCGSDTTWIINF 463 >SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharomyces pombe|chr 1|||Manual Length = 706 Score = 25.8 bits (54), Expect = 5.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 41 FNFQINLSVLTKLNFKKWVKYFLIILEERDYF 136 FN I S +TK+NF + KY + + + + +F Sbjct: 163 FNSSILFSSITKINFSRGYKYRIQLTDGKIWF 194 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,293,233 Number of Sequences: 5004 Number of extensions: 42480 Number of successful extensions: 102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -