BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40246 (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.3 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 22 5.8 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 7.7 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 7.7 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 7.7 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 7.7 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 316 VVRSWVGYMN 345 +V SW+GYMN Sbjct: 660 IVTSWLGYMN 669 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 84 KFNLVSTDKFIWKLNCPLSP 25 K NL IW L+C + P Sbjct: 12 KKNLNQNQMMIWALDCSIKP 31 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 123 SSNMIKKYFTHFLKFNLVSTDKFIWKLNCPLS 28 S++ I YF + FNL+ T +KL P++ Sbjct: 102 SADTISSYFVGKMYFNLIDTK--CYKLEHPVT 131 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 121 GTRLFSCASCDVNLTNRSELIS 186 G++ F C C + N+S L S Sbjct: 13 GSKPFKCEKCSYSCVNKSMLNS 34 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 123 SSNMIKKYFTHFLKFNLVSTDKFIWKLNCPLS 28 S++ I YF + FNL+ T +KL P++ Sbjct: 107 SADTISSYFVGKMYFNLIDTK--CYKLEHPVT 136 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 123 SSNMIKKYFTHFLKFNLVSTDKFIWKLNCPLS 28 S++ I YF + FNL+ T +KL P++ Sbjct: 107 SADTISSYFVGKMYFNLIDTK--CYKLEHPVT 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,921 Number of Sequences: 438 Number of extensions: 2925 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -