BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40245 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 190 1e-48 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 184 9e-47 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 177 1e-44 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 154 8e-38 SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) 97 1e-20 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049) 70 2e-12 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07) 42 4e-04 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) 31 1.3 SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) 30 2.2 SB_30668| Best HMM Match : NIF3 (HMM E-Value=5.1) 29 2.9 SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06) 29 2.9 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_49281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_14991| Best HMM Match : PI3_PI4_kinase (HMM E-Value=1.9) 28 6.8 SB_48208| Best HMM Match : rve (HMM E-Value=2e-20) 28 9.0 SB_55963| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_45916| Best HMM Match : Cadherin (HMM E-Value=0) 28 9.0 SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 9.0 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 190 bits (462), Expect = 1e-48 Identities = 99/152 (65%), Positives = 114/152 (75%), Gaps = 1/152 (0%) Frame = +3 Query: 246 KTSTKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIED 425 + +TKDAGTI+GLNVLRIINEPTAAAIAYGLDKK ERNVLI+DLGGGTFDVS+LTIED Sbjct: 155 RQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIED 214 Query: 426 GIFEVKSTAGDTHLGGEDFDNRMVNHFVRSSRGNTKRTSLPTRELLGVCVLHVRGQRGLV 605 GIFEVKSTAGDTHLGGEDFDN+MV+HFV+ + K+ P + + + + Sbjct: 215 GIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTL 274 Query: 606 IVHTSEH*DRFSL-*GIDFYTSITRARFEELN 698 T + SL GIDFYTSITRARFEELN Sbjct: 275 SSSTQASIEIDSLFEGIDFYTSITRARFEELN 306 Score = 137 bits (332), Expect = 7e-33 Identities = 62/87 (71%), Positives = 73/87 (83%) Frame = +1 Query: 1 LIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAE 180 LIGRKF+D V DM HWPF V+ +G +PKI+V +KGE K+FFPEE+SSMVLTKMKETAE Sbjct: 73 LIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAE 132 Query: 181 AYLGKTVQNAVITVPAYFNDSQRQAQK 261 AYLG V +AV+TVPAYF+DSQRQA K Sbjct: 133 AYLGAKVTDAVVTVPAYFHDSQRQATK 159 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 184 bits (447), Expect = 9e-47 Identities = 98/153 (64%), Positives = 111/153 (72%), Gaps = 1/153 (0%) Frame = +3 Query: 246 KTSTKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIED 425 + +TKDAG ISGLNVLRIINEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+L+IED Sbjct: 248 RQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIED 307 Query: 426 GIFEVKSTAGDTHLGGEDFDNRMVNHFVRSSRGNTKRTSLPTRELLGVCVLHVRGQRGLV 605 GIFEVKST GDTHLGGEDFDN MV+ FV+ + K+ P + L + + Sbjct: 308 GIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTL 367 Query: 606 IVHTSEH*DRFSL-*GIDFYTSITRARFEELNA 701 T + SL GIDFYTSITRARFEE+NA Sbjct: 368 SSSTQASIEIDSLYDGIDFYTSITRARFEEMNA 400 Score = 116 bits (279), Expect = 2e-26 Identities = 65/112 (58%), Positives = 74/112 (66%), Gaps = 25/112 (22%) Frame = +1 Query: 1 LIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV------------- 141 LIGR+F+D V+ DMKHW FEVV++ G+PK+KV YKGE KTFF EEV Sbjct: 73 LIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEVVNEAGRPKVKVEY 132 Query: 142 ------------SSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQAQK 261 SSMVL KMKETAEAYLG V +AV+TVPAYFNDSQRQA K Sbjct: 133 KGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATK 184 Score = 70.1 bits (164), Expect = 2e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 136 EVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQAQK 261 ++SSMVL KMKETAEAYLG V +AV+TVPAYFNDSQRQA K Sbjct: 211 QISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATK 252 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 177 bits (430), Expect = 1e-44 Identities = 95/152 (62%), Positives = 112/152 (73%), Gaps = 2/152 (1%) Frame = +3 Query: 246 KTSTKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIED 425 + +TKDAGTI+GLNVLR+INEPTAAA+AYGLDK +GE+NVLIFDLGGGTFDVSILTI+D Sbjct: 155 RQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDD 214 Query: 426 G-IFEVKSTAGDTHLGGEDFDNRMVNHFVRS-SRGNTKRTSLPTRELLGVCVLHVRGQRG 599 G +FEVKSTAGDTHLGGEDFDNR+VNHFV R K S +R + + R +R Sbjct: 215 GSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRT 274 Query: 600 LVIVHTSEH*DRFSL*GIDFYTSITRARFEEL 695 L + GIDFYT I+RARFE+L Sbjct: 275 LSSSTEASIEVDSLFEGIDFYTKISRARFEDL 306 Score = 140 bits (339), Expect = 1e-33 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +1 Query: 1 LIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAE 180 LIGR+++DATVQ+DMK WPF+++SD KPKI+V YKGE KTF EE+SSMVL KMKETAE Sbjct: 73 LIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAE 132 Query: 181 AYLGKTVQNAVITVPAYFNDSQRQAQK 261 AYLG+ V +AVITVPAYFNDSQRQA K Sbjct: 133 AYLGQKVTSAVITVPAYFNDSQRQATK 159 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 154 bits (373), Expect = 8e-38 Identities = 80/153 (52%), Positives = 104/153 (67%), Gaps = 1/153 (0%) Frame = +3 Query: 246 KTSTKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIED 425 + +TKDAG I+GL V+RIINEPTAAAIAYG+DKK GE+N+L+FDLGGGTFDVS+LTI++ Sbjct: 853 RQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKK-EGEKNILVFDLGGGTFDVSLLTIDN 911 Query: 426 GIFEVKSTAGDTHLGGEDFDNRMVNHFVR-SSRGNTKRTSLPTRELLGVCVLHVRGQRGL 602 G+FEV +T GDTHLGGEDFD ++ HF++ + K R + + + +R L Sbjct: 912 GVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRAL 971 Query: 603 VIVHTSEH*DRFSL*GIDFYTSITRARFEELNA 701 H + G DF +TRARFEELNA Sbjct: 972 STQHQARVEIESFFEGEDFSEMLTRARFEELNA 1004 Score = 118 bits (283), Expect = 6e-27 Identities = 56/87 (64%), Positives = 69/87 (79%) Frame = +1 Query: 1 LIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAE 180 LIGR ++D +VQ D+K +PF+VV KP ++V K E KTF EE+S+MVLTKMKETAE Sbjct: 771 LIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAE 830 Query: 181 AYLGKTVQNAVITVPAYFNDSQRQAQK 261 AYLGK V +AV+TVPAYFND+QRQA K Sbjct: 831 AYLGKKVTHAVVTVPAYFNDAQRQATK 857 >SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) Length = 437 Score = 97.1 bits (231), Expect = 1e-20 Identities = 44/89 (49%), Positives = 65/89 (73%) Frame = +3 Query: 246 KTSTKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIED 425 + +T A +++G+ VLR+INEPTAAA+AYGL KK G NV++ DLGGGT DVS+L I+ Sbjct: 185 RNATVKAASLAGITVLRVINEPTAAALAYGLHKK-EGVANVMVVDLGGGTLDVSLLNIQG 243 Query: 426 GIFEVKSTAGDTHLGGEDFDNRMVNHFVR 512 G+F + AG+ LGG+DF+ R + + ++ Sbjct: 244 GMFVTMAMAGNNRLGGQDFNARFMQYLLQ 272 Score = 47.6 bits (108), Expect = 1e-05 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 1/94 (1%) Frame = +1 Query: 4 IGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAE 180 IG+ F + K + F V +D G V KG PEE+ V+ K++ AE Sbjct: 103 IGKTFTKQELLEIGKLYQFRVTTDKRGNAGFLVGKKGNFTVITPEEIGGYVIKKLRTMAE 162 Query: 181 AYLGKTVQNAVITVPAYFNDSQRQAQKMQVPSLA 282 L TV AV++VPA F+ QR A ++ SLA Sbjct: 163 RNLTTTVTKAVMSVPAEFDIKQRNA-TVKAASLA 195 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 73.7 bits (173), Expect = 1e-13 Identities = 29/48 (60%), Positives = 40/48 (83%) Frame = +3 Query: 366 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFV 509 + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++ + Sbjct: 2 IAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLI 49 Score = 31.1 bits (67), Expect = 0.96 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +2 Query: 503 LCQEFKRKYKKDLATNKRALRRLRTACERAK 595 L EFK++ DL+ + AL+RLR A E+AK Sbjct: 48 LIAEFKKESGVDLSKDSMALQRLREAAEKAK 78 >SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/84 (42%), Positives = 53/84 (63%), Gaps = 1/84 (1%) Frame = +1 Query: 4 IGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAE 180 IGRKF D VQ ++ H P++VV I+V Y G+ + F PE+V +M+ T++K TAE Sbjct: 130 IGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAMLFTRLKTTAE 189 Query: 181 AYLGKTVQNAVITVPAYFNDSQRQ 252 L V + VI+VP+Y+ D QR+ Sbjct: 190 IALKTKVTDCVISVPSYYTDRQRR 213 Score = 68.5 bits (160), Expect = 5e-12 Identities = 51/155 (32%), Positives = 78/155 (50%), Gaps = 8/155 (5%) Frame = +3 Query: 261 DAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLIFDLGGGTFDVSILTIEDGI 431 DA +GLN LR++N+ TA ++AYG+ K+ RNV+ D+G + V I G Sbjct: 217 DASATAGLNCLRLMNDTTAVSLAYGIYKQDLPTDKPRNVVFVDIGHSSLQVCITAFLKGQ 276 Query: 432 FEVKSTAGDTHLGGEDFDNRMVNHFVRSSRGNTK---RTSLPTRELLGVCVLHVRGQRGL 602 +V STA + +LGG DFD +V HF + + K +S+ + LG + L Sbjct: 277 LKVLSTAVEPNLGGRDFDYVLVEHFAQEFKTKYKIDVHSSIKAKIKLGA---ECEKLKKL 333 Query: 603 VIVHTSEH*DRFS--L*GIDFYTSITRARFEELNA 701 + +TSE + D + + RA+FEEL A Sbjct: 334 MSANTSEIPINIECFMEDKDVHGRMKRAQFEELAA 368 >SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049) Length = 179 Score = 69.7 bits (163), Expect = 2e-12 Identities = 32/57 (56%), Positives = 45/57 (78%) Frame = +1 Query: 91 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQAQK 261 I V GE ++F PE++S++VL ++K AEA+LG+ V+ AVITVPA+FND+QRQA K Sbjct: 2 IAVEVCGEKRSFAPEQISAVVLEQLKADAEAFLGQAVKRAVITVPAHFNDAQRQATK 58 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 2/28 (7%) Frame = +3 Query: 288 VLRIINEPTAAAIAYGLDKK--GTGERN 365 VLRIINEPTAAAIAYGLDK G ERN Sbjct: 92 VLRIINEPTAAAIAYGLDKARGGKAERN 119 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 45.2 bits (102), Expect = 6e-05 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +1 Query: 85 PKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQA 255 P +K Y+ D TF PEE+ M+L + E + +++ V+TVP +FN ++R+A Sbjct: 68 PHVK-NYQQSDVTFTPEELMGMILNHSRFIGEQFADHPIKDVVLTVPPFFNQAERRA 123 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 16/106 (15%) Frame = +3 Query: 264 AGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLGGGTFDVSIL------ 413 A + GLNVL+I+N TA A+ YGL ++ T E++ + +D+G + +I+ Sbjct: 127 AAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMGASSTVATIVGYSMTK 186 Query: 414 TIEDGIFE------VKSTAGDTHLGGEDFDNRMVNHFVRSSRGNTK 533 T + GI E +K D LGG D R+ +H V+ + N K Sbjct: 187 TKDRGISETAPQLVIKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYK 232 >SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07) Length = 592 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/48 (35%), Positives = 34/48 (70%) Frame = +3 Query: 357 ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVN 500 + VL++ LGG + DV++L++ +G+++V +T D LGG +FD +++ Sbjct: 153 DSTVLVYRLGGASHDVTLLSVINGMYKVLATEYDGALGGRNFDEVLLD 200 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 33.1 bits (72), Expect = 0.24 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +3 Query: 315 AAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 482 A A L +G E + D G GT VS + +E+G +++ D H+ G F Sbjct: 1505 AGAGGLSLAIEGPSEAKLTCQDNGDGTCSVSYIPVEEGDYDIHIKFADEHIPGSPF 1560 Score = 31.1 bits (67), Expect = 0.96 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 363 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 482 + LI D G+F VS E+GI ++ GD H+ G F Sbjct: 1428 DTLITDNQDGSFGVSYTPFEEGIHDLAVKFGDDHIPGSPF 1467 Score = 28.7 bits (61), Expect = 5.1 Identities = 19/64 (29%), Positives = 27/64 (42%) Frame = +3 Query: 303 NEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 482 N P A + GT E +I DLG G + + + E G V +TH+ G F Sbjct: 3007 NAPVGKVSATVIAPSGT-ESKAVISDLGKGNYAIRFVPKEFGDHLVNVKFDETHIPGSPF 3065 Query: 483 DNRM 494 R+ Sbjct: 3066 KIRV 3069 >SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) Length = 634 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +3 Query: 366 VLIFDLGGGTFDVSILTIEDGIFEVK 443 V I+DLG GT++++IL E G++ ++ Sbjct: 319 VPIYDLGNGTYEMAILFHEPGVYSIR 344 >SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) Length = 600 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 372 IFDLGGGTFDVSILTIEDGIFEV 440 +FDLG G+++V L +E G++ V Sbjct: 311 VFDLGNGSYEVLFLVMEPGVYRV 333 >SB_30668| Best HMM Match : NIF3 (HMM E-Value=5.1) Length = 1318 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = -2 Query: 502 WLTMRLSKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP 332 +L +L P KW P D +S P V + + PP S + PF+S+P Sbjct: 351 YLATKLQTEDPTKW-PPRYDDSSHFPHLWVVLSYDESTPPPRDGSAKPATQPFVSQP 406 >SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06) Length = 799 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 463 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVP 347 +++PA+ S +PS V +D VP P I+ + VP Sbjct: 267 YLTPAISTQSTLPSGTVTLDQHNVPHPSGTITLDQHNVP 305 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.1 bits (62), Expect = 3.9 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 7/69 (10%) Frame = -1 Query: 449 GGFHLEDTILDGKDGHVEGTAAEVK--DKYISFSSTLFVKTVSNRSSS--RFIDDSENVQ 282 G F L D+ G++GH EG+ +EV + ++ + F +T S S F ++S ++Q Sbjct: 285 GVFVLVDSKDSGENGHTEGSNSEVGTIENFVKTQTKQFKQTACKYSESNLEFNENSAHLQ 344 Query: 281 ---ARDGTC 264 AR TC Sbjct: 345 VYNARISTC 353 Score = 29.1 bits (62), Expect = 3.9 Identities = 22/75 (29%), Positives = 32/75 (42%) Frame = -2 Query: 508 TKWLTMRLSKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP* 329 + W+ KS K P +S + SS TSK PP + +ST SP Sbjct: 1244 SSWMVTNCQKSC--KRCPPEPPTSSIMQSSSNIPTTSKTPPSSTCLSTAVSPAAGADSNN 1301 Query: 328 AIAAAVGSLMIRRTF 284 A+ A+ SL++ F Sbjct: 1302 AVNVAISSLVLPSLF 1316 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 379 TSAAVPSTCPSLPSRMVSSR*NPPPATP 462 T A P P++PSR +R PPP P Sbjct: 784 TKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_49281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 962 Score = 28.3 bits (60), Expect = 6.8 Identities = 25/77 (32%), Positives = 35/77 (45%) Frame = -2 Query: 484 SKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP*AIAAAVGS 305 S +S P V P T IP ++ DT+ PP S S F++ S AV S Sbjct: 704 SPTSAPTLVVPPTSTT--IP--LLTADTTTSKPPSSSTSIFQAAPATTSNTTTQIPAVAS 759 Query: 304 LMIRRTFKPEMVPASFV 254 + T KP ++PA+ V Sbjct: 760 -KLPDTTKPPILPANLV 775 >SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 28.3 bits (60), Expect = 6.8 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = -1 Query: 179 SAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSACTVASSNLRP 6 S F+F ST + +S +KV+ SPL + + P+ G S C V + + P Sbjct: 1108 SPAKFVFTSTGIVRASTRKVVPSPLRRSKVPPTVPAQRLFNGDRVESICNVQNLSRCP 1165 >SB_14991| Best HMM Match : PI3_PI4_kinase (HMM E-Value=1.9) Length = 235 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 209 QLSRFPRTSMTLKDKHKRCRYHLWLERSP 295 ++ R PR TLKD+ K RY + ERSP Sbjct: 84 RIRRIPRDD-TLKDRRKGSRYDAFEERSP 111 >SB_48208| Best HMM Match : rve (HMM E-Value=2e-20) Length = 1557 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = -2 Query: 502 WLTMRLSKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP 332 + +L P KW D T I +V PPPR + + +PF+S+P Sbjct: 558 YFATKLQTEDPTKWPPSYEDSTHFIHLWVVLSYEESTPPPRDGTAKL-ATLPFVSQP 613 >SB_55963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 644 KRESISMLACVDDDKSSLPSHMQY 573 K SIS+ C DD K +LPS + Y Sbjct: 7 KESSISIKLCYDDFKCTLPSSVSY 30 >SB_45916| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1774 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 374 DKYISFSSTLFVKTVSNRSSSRFIDDSEN 288 +K ISF +LF+ VSN S+ R+I +E+ Sbjct: 752 NKVISFGPSLFMDKVSNASAGRYICIAES 780 >SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 869 Score = 27.9 bits (59), Expect = 9.0 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = -2 Query: 724 NGRPETDPAFSSSKRARVIDV*KSIPQRENLSQCSLVWTMTSPLCPLTCSTQTPKSSLVG 545 N PE P F+S +A D+ + E L L + SPLCP T S++ + Sbjct: 610 NENPEARPTFTSLVQA-FDDLVALLSDEEYLE---LQGPLLSPLCPRTASSELAPFARDN 665 Query: 544 SEVLFVFPLELLTK---WLTMRLSKSS 473 + F E LTK L++R SK+S Sbjct: 666 ASSEFTSSSENLTKSENSLSVRDSKTS 692 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,450,648 Number of Sequences: 59808 Number of extensions: 498906 Number of successful extensions: 1886 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1861 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -