BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40244 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41092| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39600| Best HMM Match : Sushi (HMM E-Value=0) 28 8.0 >SB_41092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/77 (44%), Positives = 52/77 (67%) Frame = +2 Query: 278 KRAQKGAGGIKTLYHTKDIKFLLHEPIIWKLRELKVYQQKIRRARAQREYGKMRKFLRDY 457 K+ KG+ KT Y+ KDI++L HEP++ K RE KV+ +K+++A A+ + G + + Sbjct: 18 KKVNKGSTANKTYYYVKDIQWLAHEPVLNKFREFKVFLRKLKKAIAKEQPGTADRLEDNK 77 Query: 458 PEINIDHIVKERYPTFV 508 P +DHIVKERYPTF+ Sbjct: 78 PVYTLDHIVKERYPTFI 94 >SB_39600| Best HMM Match : Sushi (HMM E-Value=0) Length = 1368 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 532 NHPNLAKHNKRGVSFLYYVINVYFWIVPQKLSHLA 428 NHP+ A H + FLY V+ +V SH++ Sbjct: 725 NHPSNANHPNHSLCFLYLVVTCKVRLVLYASSHIS 759 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,012,215 Number of Sequences: 59808 Number of extensions: 393856 Number of successful extensions: 952 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 952 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -