BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40244 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 29 0.041 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.2 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.7 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 6.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.2 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 29.1 bits (62), Expect = 0.041 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 503 TWGIFPLLCDQCLFLDSPAKTFSSCHILAVLLHDEFFVDKPLVPS 369 TW + P+LCD + LD T S + A+ + V +PL+ S Sbjct: 103 TWELGPMLCDSWVSLDILLCTASILSLCAISIDRYLAVTQPLIYS 147 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/63 (20%), Positives = 26/63 (41%) Frame = +1 Query: 307 QNTLSH*RYKIFTTRANNMETEGTKGLSTKNSSCKSTARIWQDEKVFAGLSRNKH*SHSK 486 +N +H + + + E +K ++ +C + IW+ K R + S S Sbjct: 285 ENETAHIKDSLIVLTSALQEMNKSKSITEPPKNCADSGSIWETGKNLFEFIRKQVLSGST 344 Query: 487 GKI 495 GK+ Sbjct: 345 GKV 347 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 472 NVYFWIVPQKLSHLAIFSLCSCTTNFLLIN 383 N Y WIV K +A L NF ++N Sbjct: 370 NEYIWIVSNKYQKIANGDLNFNEVNFRILN 399 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 490 FLYYVINVYFWIV 452 FL+ V+NV +WI+ Sbjct: 411 FLFAVLNVTYWIM 423 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = -1 Query: 503 TWGIFPLLCDQCLFLDSPAKTFSSCHILAVLLHDEFFVDKPL 378 +W + +CD + +D T S +++A+ + V +P+ Sbjct: 251 SWSLPGFVCDFYIAMDVTCSTSSIFNLVAISIDRYIAVTQPI 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,560 Number of Sequences: 438 Number of extensions: 3947 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -