BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40242 (619 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31300.1 68414.m03830 expressed protein similar to hypothetic... 29 1.9 At5g58610.1 68418.m07345 PHD finger transcription factor, putative 27 7.5 At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase famil... 27 7.5 At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase famil... 27 7.5 >At1g31300.1 68414.m03830 expressed protein similar to hypothetical protein GB:AAF24587 GI:6692122 from [Arabidopsis thaliana] Length = 278 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 508 TAHIVVSLHHTLPHLVQILILSDHFYCHTKL*RGIF 401 T + S HH HLV+ +L+D F +T + GIF Sbjct: 8 TIGAIKSYHHQAQHLVKNYLLADPFIPYTSVLTGIF 43 >At5g58610.1 68418.m07345 PHD finger transcription factor, putative Length = 1065 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +2 Query: 107 SLSEGVHCTVKYEDKIYRAIL---EDISSKIKVSLPDYGNEIITKLENLMILQ 256 +L+ G+ V + D + +L E+ S K +V PD G+E+ L++L I Q Sbjct: 106 NLAYGLCVDVFFSDAWWEGVLFDHENGSEKRRVFFPDLGDELDADLQSLRITQ 158 >At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = +1 Query: 364 GDKFIIYINSVNEICLSTTLYDSKSGQKVSIFEPDEGAYDEVIQLCERSSLIITSDL 534 G++ +IY S+NE +ST + DSK +K+S + +I + E + +SD+ Sbjct: 189 GEEALIY--SLNETRVSTLICDSKQLKKLSAIQSSLKTVKNIIYIEEDGVDVASSDV 243 >At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = +1 Query: 364 GDKFIIYINSVNEICLSTTLYDSKSGQKVSIFEPDEGAYDEVIQLCERSSLIITSDL 534 G++ +IY S+NE +ST + DSK +K+S + +I + E + +SD+ Sbjct: 189 GEEALIY--SLNETRVSTLICDSKQLKKLSAIQSSLKTVKNIIYIEEDGVDVASSDV 243 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,452,170 Number of Sequences: 28952 Number of extensions: 238454 Number of successful extensions: 583 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -