BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40238 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22410.1 68417.m03238 ubiquitin carboxyl-terminal hydrolase f... 118 4e-27 At4g22350.1 68417.m03231 ubiquitin carboxyl-terminal hydrolase f... 118 4e-27 At4g22290.1 68417.m03224 ubiquitin carboxyl-terminal hydrolase f... 88 4e-18 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 38 0.004 At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase f... 38 0.006 At4g22420.1 68417.m03240 expressed protein predicted protein, Ar... 35 0.041 At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putativ... 34 0.071 At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase f... 33 0.12 At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22) ... 32 0.29 At5g37210.1 68418.m04468 DC1 domain-containing protein contains ... 30 1.2 At1g29180.1 68414.m03570 DC1 domain-containing protein contains ... 30 1.5 At5g48320.1 68418.m05969 DC1 domain-containing protein contains ... 29 2.0 At4g13130.1 68417.m02045 DC1 domain-containing protein contains ... 29 2.0 At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) ... 29 2.0 At4g10590.2 68417.m01733 ubiquitin carboxyl-terminal hydrolase f... 29 2.7 At4g10590.1 68417.m01732 ubiquitin carboxyl-terminal hydrolase f... 29 2.7 At4g10570.1 68417.m01730 ubiquitin carboxyl-terminal hydrolase f... 29 2.7 At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase f... 29 3.5 At4g22370.1 68417.m03233 hypothetical protein 28 4.7 At4g15070.1 68417.m02315 DC1 domain-containing protein contains ... 28 4.7 At4g10560.1 68417.m01729 DC1 domain-containing protein contains ... 28 4.7 At2g29650.3 68415.m03602 inorganic phosphate transporter, putati... 28 4.7 At2g29650.2 68415.m03604 inorganic phosphate transporter, putati... 28 4.7 At2g29650.1 68415.m03603 inorganic phosphate transporter, putati... 28 4.7 At2g04480.1 68415.m00452 hypothetical protein 28 4.7 At1g62030.1 68414.m06996 DC1 domain-containing protein contains ... 28 4.7 At3g26550.1 68416.m03314 DC1 domain-containing protein contains ... 28 6.2 At2g42610.2 68415.m05274 expressed protein contains Pfam profile... 28 6.2 At2g42610.1 68415.m05273 expressed protein contains Pfam profile... 28 6.2 At5g45150.1 68418.m05543 ribonuclease III family protein similar... 27 8.2 At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) ... 27 8.2 >At4g22410.1 68417.m03238 ubiquitin carboxyl-terminal hydrolase family protein similar to U4/U6.U5 tri-snRNP-associated 65 kDa protein [Homo sapiens] GI:13926071; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 340 Score = 118 bits (283), Expect = 4e-27 Identities = 50/87 (57%), Positives = 67/87 (77%) Frame = +3 Query: 255 KYFQGRGTNTHAYTHSVADGHHVFLNLNTLKFYCLPDNYEVIDSSLNDIKYVLNPTFTPE 434 KYFQGR +HAYTHS+ GHHV++NL T K YCLPD+YE+ D SL+DI++VLNP F+ Sbjct: 32 KYFQGRSQKSHAYTHSLEAGHHVYINLLTEKVYCLPDSYEINDPSLDDIRHVLNPRFSRA 91 Query: 435 QIKLIDTNTKMSRAIDGTMYMPGIVAL 515 Q+ +D N + SRA+DG+ Y+PG+V L Sbjct: 92 QVNELDKNRQWSRALDGSDYLPGMVGL 118 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 178 VLDFDFEKLCSVSLTRINVYACLVCGNIFR 267 VLDF FE+ CSVSL+ +NVYACLVCG F+ Sbjct: 6 VLDFHFERFCSVSLSNLNVYACLVCGKYFQ 35 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYF 592 GLNNI+ ++ NV +Q L +V PLRN+F Sbjct: 117 GLNNIQKTEFVNVTIQSLMRVTPLRNFF 144 >At4g22350.1 68417.m03231 ubiquitin carboxyl-terminal hydrolase family protein similar to U4/U6.U5 tri-snRNP-associated 65 kDa protein [Homo sapiens] GI:13926071; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 510 Score = 118 bits (283), Expect = 4e-27 Identities = 50/87 (57%), Positives = 67/87 (77%) Frame = +3 Query: 255 KYFQGRGTNTHAYTHSVADGHHVFLNLNTLKFYCLPDNYEVIDSSLNDIKYVLNPTFTPE 434 KYFQGR +HAYTHS+ GHHV++NL T K YCLPD+YE+ D SL+DI++VLNP F+ Sbjct: 116 KYFQGRSQKSHAYTHSLEAGHHVYINLLTEKVYCLPDSYEINDPSLDDIRHVLNPRFSRA 175 Query: 435 QIKLIDTNTKMSRAIDGTMYMPGIVAL 515 Q+ +D N + SRA+DG+ Y+PG+V L Sbjct: 176 QVNELDKNRQWSRALDGSDYLPGMVGL 202 Score = 81.0 bits (191), Expect = 6e-16 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = +1 Query: 94 DENGTDKQGRYSKTQQIQ--CPYLDTINRHVLDFDFEKLCSVSLTRINVYACLVCGNIFR 267 D++ + +G++S+ +++ CPYLDT+NR VLDFDFE+ CSVSL+ +NVYACLVCG F+ Sbjct: 60 DDDASKGRGKHSRHVEVRRDCPYLDTVNRQVLDFDFERFCSVSLSNLNVYACLVCGKYFQ 119 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFL 595 GLNNI+ ++ NV +Q L +V PLRN+FL Sbjct: 201 GLNNIQKTEFVNVTIQSLMRVTPLRNFFL 229 >At4g22290.1 68417.m03224 ubiquitin carboxyl-terminal hydrolase family protein similar to pVHL-interacting deubiquitinating enzyme 1 type II [Homo sapiens] GI:18698435; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 974 Score = 88.2 bits (209), Expect = 4e-18 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = +3 Query: 255 KYFQGRGTNTHAYTHSVADGHHVFLNLNTLKFYCLPDNYEVIDSSLNDIKYVLNPTF 425 KYFQGR +HAYTHS+ GHHV++NL T K YCLPD+YE+ D SL+DI++VLNP + Sbjct: 578 KYFQGRSQKSHAYTHSLEAGHHVYINLLTEKVYCLPDSYEINDPSLDDIRHVLNPRY 634 Score = 80.2 bits (189), Expect = 1e-15 Identities = 36/77 (46%), Positives = 54/77 (70%), Gaps = 3/77 (3%) Frame = +1 Query: 46 DSNKMTEEQSRKRKITDENGTDK-QGRYSKTQQIQ--CPYLDTINRHVLDFDFEKLCSVS 216 + NK+ E + +++ K +G++S+ +++ CPYLDT+NR VLDFDFE+ CSVS Sbjct: 505 NGNKVKGEAQEEVDDDEDDDVSKGKGKHSRHVEVRRDCPYLDTVNRQVLDFDFERFCSVS 564 Query: 217 LTRINVYACLVCGNIFR 267 L+ +NVYACLVCG F+ Sbjct: 565 LSNLNVYACLVCGKYFQ 581 Score = 33.9 bits (74), Expect = 0.094 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +3 Query: 423 FTPEQIKLIDTNTKMSRAIDGTMYMPGIVA 512 F+ Q+ +D N + SRA+DG+ Y+PG+V+ Sbjct: 687 FSRAQVNELDKNRQWSRALDGSDYLPGMVS 716 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/38 (50%), Positives = 21/38 (55%) Frame = +2 Query: 482 WHNVYAWHCGLNNIKANDYCNVILQCLSQVRPLRNYFL 595 W N CGL N + + NVILQCLS RPL Y L Sbjct: 160 WDNPELAPCGLMNCGNSCFANVILQCLSWTRPLVAYLL 197 >At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 672 Score = 37.9 bits (84), Expect = 0.006 Identities = 24/64 (37%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +2 Query: 434 TDQAYRY*HKNVTSH*WHNVYAWHCGLNNIKANDYCNVILQCLSQVRPLRNYFL-RARLC 610 TD + Y V + W CGL N + + NV+LQCLS RPL Y L R Sbjct: 151 TDVLFPY-ESFVRYYNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKR 209 Query: 611 SCTR 622 C R Sbjct: 210 ECRR 213 >At4g22420.1 68417.m03240 expressed protein predicted protein, Arabidopsis thaliana Length = 184 Score = 35.1 bits (77), Expect = 0.041 Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +1 Query: 52 NKMTEEQSRKRKITDENGTDKQGRYSKTQQIQ--CPYLDTINRHVLDFD 192 N +E+ + D++ + +G++S+ +++ CPYLDT+NR V+ D Sbjct: 98 NGEAQEEVDDEEDDDDDASKGRGKHSRHVEVRRDCPYLDTVNRQVIIID 146 >At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putative (UBP16) similar to ubiquitin-specific protease 16 GI:11993477 [Arabidopsis thaliana] Length = 1008 Score = 34.3 bits (75), Expect = 0.071 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 506 CGLNNIKANDYCNVILQCLSQVRPLRNYFLR 598 CGL N+ + + NV+ QCL PL YFL+ Sbjct: 542 CGLINVGNSCFANVVFQCLMFTPPLTTYFLQ 572 >At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 16 (UBP16) [Arabidopsis thaliana] GI:11993477; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 731 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFLR 598 GL N+ + Y N +LQCL+ RPL +Y +R Sbjct: 330 GLVNLGNSCYANAVLQCLAFTRPLISYLIR 359 >At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22) almost identical to ubiquitin-specific protease 22 GI:11993484 [Arabidopsis thaliana], one amino acid difference Length = 557 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFL 595 GLNN+ + + N +LQ L PLRN++L Sbjct: 178 GLNNLGSTCFMNAVLQALVHAPPLRNFWL 206 >At5g37210.1 68418.m04468 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 625 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +1 Query: 184 DFDFEKLCSVSLTRI---NVYACLVCGNIFREEAPTL 285 ++D ++LC +T I N+Y+C+ CG + E+ L Sbjct: 387 EYDEDRLCQACITPIYFGNLYSCMQCGFVLHEKCAEL 423 >At1g29180.1 68414.m03570 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 444 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +1 Query: 184 DFDFEKLCSVSLTRI---NVYACLVCGNIFREEAPTL 285 D+D K C +T I N+Y+C+ C I EE L Sbjct: 172 DYDDSKQCDACITPIYFGNLYSCIQCSFILHEECANL 208 >At5g48320.1 68418.m05969 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 977 Score = 29.5 bits (63), Expect = 2.0 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 5/91 (5%) Frame = +1 Query: 28 TLSKVYDSNKMTEEQSRKRKITDENGTDKQG--RYSKTQQIQCPYLDTINRHVLDFDFEK 201 T S V+D ++ E K + T + G R+ + I+R D++ K Sbjct: 647 TQSNVWDGKELEGEPEEDIKKIEPFVTVRDGIIRHFSHDHHHLKLDENIDR---DYNENK 703 Query: 202 LCSVSLTRI---NVYACLVCGNIFREEAPTL 285 LC +T I N Y+C+ C I EE L Sbjct: 704 LCQACITPIYFGNFYSCMQCDFILHEECAKL 734 >At4g13130.1 68417.m02045 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 767 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +1 Query: 184 DFDFEKLCSVSLTRI---NVYACLVCGNIFREE 273 D+D K C +T I N+Y+C+ C I EE Sbjct: 471 DYDENKQCQACITPIYFGNIYSCMQCNFILHEE 503 >At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) similar to GI:11993490 Length = 661 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFL 595 GL N+ Y N +LQCL+ PL N+ L Sbjct: 25 GLRNLGNTCYLNSVLQCLTFTPPLANFCL 53 >At4g10590.2 68417.m01733 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 910 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFLR 598 GL+N+ + N LQCL+ P+ YFL+ Sbjct: 304 GLSNLGNTCFMNSALQCLAHTPPIVEYFLQ 333 >At4g10590.1 68417.m01732 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 910 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFLR 598 GL+N+ + N LQCL+ P+ YFL+ Sbjct: 304 GLSNLGNTCFMNSALQCLAHTPPIVEYFLQ 333 >At4g10570.1 68417.m01730 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 923 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFLR 598 GL+N+ + N LQCL+ P+ YFL+ Sbjct: 305 GLSNLGNTCFMNSALQCLAHTPPIVEYFLQ 334 >At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 892 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFLR 598 GL N+ + N LQCL+ P+ YFL+ Sbjct: 302 GLQNLGNTCFMNSTLQCLAHTPPIVEYFLQ 331 >At4g22370.1 68417.m03233 hypothetical protein Length = 205 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +1 Query: 4 RFQILHLTTLSKVYDS--NKMTEEQSRKRKITDENGTDKQGRYSKTQQIQCPYLDTINRH 177 R + H T + K + EE+S + + DE DK+ Y + I Y D +R+ Sbjct: 56 RSTLKHYTRVRKSESDWEESIDEEKSDQEESEDEENDDKKEDYRAKETILKLYTDIKDRN 115 Query: 178 VLDFDF 195 +++ D+ Sbjct: 116 IMEKDY 121 >At4g15070.1 68417.m02315 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 889 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +1 Query: 184 DFDFEKLCSVSLTRI---NVYACLVCGNIFREEAPTL 285 D++ KLC +T I NVY+C+ C EE L Sbjct: 664 DYNENKLCQACITPIYFGNVYSCMQCDFSLHEECAKL 700 >At4g10560.1 68417.m01729 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 703 Score = 28.3 bits (60), Expect = 4.7 Identities = 25/91 (27%), Positives = 36/91 (39%), Gaps = 5/91 (5%) Frame = +1 Query: 28 TLSKVYDSNKMTEEQSRKRKITDENGTDKQG--RYSKTQQIQCPYLDTINRHVLDFDFEK 201 T V+D ++ EQ + K + G ++ Q D INR D+D K Sbjct: 378 TQRNVWDGKELEGEQEEEIKEVEPFVKISDGIIQHFSHQHHHLRLDDNINR---DYDENK 434 Query: 202 LCSVSLTRI---NVYACLVCGNIFREEAPTL 285 C + I N Y+C+ C I EE L Sbjct: 435 ECQACIRPIYFGNFYSCMQCEFILHEECANL 465 >At2g29650.3 68415.m03602 inorganic phosphate transporter, putative similar to brain specific Na+-dependent inorganic phosphate cotransporter [Rattus norvegicus] GI:507415; contains Pfam profile PF00083: major facilitator superfamily protein Length = 400 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +3 Query: 414 NPTFTPEQIKLIDTNTKMSRAIDGTMYMPGIVALIISRPMITVM*FCSVCHKY 572 +PT PE+ KLI N + + LI+S+P + + C CH + Sbjct: 176 DPTLLPEERKLIADNCASKEPVKSIPWR-----LILSKPPVWALISCHFCHNW 223 >At2g29650.2 68415.m03604 inorganic phosphate transporter, putative similar to brain specific Na+-dependent inorganic phosphate cotransporter [Rattus norvegicus] GI:507415; contains Pfam profile PF00083: major facilitator superfamily protein Length = 398 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +3 Query: 414 NPTFTPEQIKLIDTNTKMSRAIDGTMYMPGIVALIISRPMITVM*FCSVCHKY 572 +PT PE+ KLI N + + LI+S+P + + C CH + Sbjct: 288 DPTLLPEERKLIADNCASKEPVKSIPWR-----LILSKPPVWALISCHFCHNW 335 >At2g29650.1 68415.m03603 inorganic phosphate transporter, putative similar to brain specific Na+-dependent inorganic phosphate cotransporter [Rattus norvegicus] GI:507415; contains Pfam profile PF00083: major facilitator superfamily protein Length = 512 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +3 Query: 414 NPTFTPEQIKLIDTNTKMSRAIDGTMYMPGIVALIISRPMITVM*FCSVCHKY 572 +PT PE+ KLI N + + LI+S+P + + C CH + Sbjct: 288 DPTLLPEERKLIADNCASKEPVKSIPWR-----LILSKPPVWALISCHFCHNW 335 >At2g04480.1 68415.m00452 hypothetical protein Length = 247 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 285 HAYTHSVADGHHVFLNLNTLKFYCLPDNYEVIDSSLNDIKY 407 H Y H+ +F LN + + DN ID S+ IKY Sbjct: 200 HLYIHNKVQDFRLFDLLNEINDFTEEDNLIEIDISIGSIKY 240 >At1g62030.1 68414.m06996 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 743 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 184 DFDFEKLCSVSLTRI---NVYACLVCGNIFREEAPTL 285 D+D KLC + I N Y+C+ C I E+ L Sbjct: 435 DYDVNKLCQACIMPIYSGNFYSCMQCDYILHEKCANL 471 >At3g26550.1 68416.m03314 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 681 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 205 CSVSLTRINVYACLVCGNIFREE 273 C S T + YACL CGN F ++ Sbjct: 128 CEESKTSRSYYACLECGNKFHKQ 150 >At2g42610.2 68415.m05274 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 177 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = +1 Query: 118 GRYSKTQQIQCPYLDTINRHVLDFDFEKLCSVSLTRINVYACLVCGNIFREEAPTLMPTH 297 G+Y K Q+ P HVLDF L T+++V C+ G AP P Sbjct: 38 GQYLKNQRPPVPMSHCSCNHVLDF-LRYLDQFGKTKVHVPGCMFYGQP-EPPAPCTCPLR 95 Query: 298 IQW 306 W Sbjct: 96 QAW 98 >At2g42610.1 68415.m05273 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 177 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = +1 Query: 118 GRYSKTQQIQCPYLDTINRHVLDFDFEKLCSVSLTRINVYACLVCGNIFREEAPTLMPTH 297 G+Y K Q+ P HVLDF L T+++V C+ G AP P Sbjct: 38 GQYLKNQRPPVPMSHCSCNHVLDF-LRYLDQFGKTKVHVPGCMFYGQP-EPPAPCTCPLR 95 Query: 298 IQW 306 W Sbjct: 96 QAW 98 >At5g45150.1 68418.m05543 ribonuclease III family protein similar to CAF protein (RNA helicase/RNAseIII) [Arabidopsis thaliana] GI:6102610; contains Pfam profiles PF00035: Double-stranded RNA binding motif, PF00636 RNase3 domain Length = 957 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 22/32 (68%) Frame = +1 Query: 52 NKMTEEQSRKRKITDENGTDKQGRYSKTQQIQ 147 N +TEE ++++ + DE+ D + + +T+++Q Sbjct: 676 NPLTEEMTQEQMVIDEDSLDVEWKLFETEELQ 707 >At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) almost identical to ubiquitin-specific protease 15 GI:11993475 [Arabidopsis thaliana], 7 amino acid difference Length = 924 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +2 Query: 509 GLNNIKANDYCNVILQCLSQVRPLRNYFLR---ARLCS 613 GL N + Y N +LQ L+ +PL Y LR +R CS Sbjct: 439 GLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSRSCS 476 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,577,920 Number of Sequences: 28952 Number of extensions: 276273 Number of successful extensions: 755 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -