BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40235 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0629 + 22920206-22920291,22920430-22920527,22920657-229207... 29 2.6 04_04_1185 - 31562061-31562519,31562962-31563026,31563384-31563420 29 3.5 01_01_0328 - 2664412-2664535,2665388-2665465,2667784-2667895,266... 28 6.1 >06_03_0629 + 22920206-22920291,22920430-22920527,22920657-22920796, 22921596-22921626,22922025-22922128,22922439-22922560, 22922651-22923050,22923245-22923268 Length = 334 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 417 FDFLSFIIHLQNVFCFVMEFVIL 349 FD L+F+ QNV CFV F+++ Sbjct: 41 FDHLAFLNFAQNVVCFVWSFIMI 63 >04_04_1185 - 31562061-31562519,31562962-31563026,31563384-31563420 Length = 186 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -1 Query: 588 FTIFFFSLNYIYHSFAFFVKQICT*LLTRVYPCVSSLPALTIHCCDASS 442 F+ + + H+F+ F K IC + +Y +L TI C AS+ Sbjct: 92 FSCHLLACGLLVHAFSDFTKDICNFTVVALYGTYDTLHPETIEQCRAST 140 >01_01_0328 - 2664412-2664535,2665388-2665465,2667784-2667895, 2668344-2668410,2668473-2668562,2668672-2668787, 2668999-2671924 Length = 1170 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -1 Query: 489 VSSLPALTIHCCDASSSTPLSMLVFDFLSFIIHLQNVFCFVMEFVILSDKVYS 331 ++SL L++HCC S P S++ +SF+ Q V + + K+Y+ Sbjct: 601 LTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYN 653 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,999,138 Number of Sequences: 37544 Number of extensions: 266292 Number of successful extensions: 392 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -