BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40233 (669 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92972-3|CAB07488.1| 317|Caenorhabditis elegans Hypothetical pr... 30 1.3 AL132860-20|CAB60503.2| 263|Caenorhabditis elegans Hypothetical... 28 6.9 >Z92972-3|CAB07488.1| 317|Caenorhabditis elegans Hypothetical protein T19C9.3 protein. Length = 317 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 158 VVVCHECMTCLIKVYVIQNKLKNRVKNVK 72 +V C E TC+ Y IQ+K ++K+VK Sbjct: 19 LVTCFEIPTCIYGAYCIQSKTPEKMKSVK 47 >AL132860-20|CAB60503.2| 263|Caenorhabditis elegans Hypothetical protein Y56A3A.22 protein. Length = 263 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = +2 Query: 503 QISKTH*TQQHYS*RHLGPKNIKRRDYIHCYKMQIINISK 622 +++K H ++ Y RHLG +++ R++ +H I + + Sbjct: 197 ELNKAHYGRRWYRYRHLGVRSVSRKNSVHATTAHIGQVQR 236 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,673,081 Number of Sequences: 27780 Number of extensions: 304602 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -