Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40233
         (669 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g44240.1 68418.m05412 haloacid dehalogenase-like hydrolase fa...    33   0.23 

>At5g44240.1 68418.m05412 haloacid dehalogenase-like hydrolase
           family protein similar to Potential
           phospholipid-transporting ATPase (EC 3.6.3.1) from {Mus
           musculus} SP|P70704, {Bos taurus} SP|Q29449; contains
           InterPro accession IPR005834: Haloacid dehalogenase-like
           hydrolase
          Length = 1107

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = -1

Query: 429 LIFILGMYQYNTTRFVSV***YKYYKNTLRQQIVFFFVILEEILSRS--NKI-IMLYNLS 259
           LI + G Y YN T F+S    Y +YK+ L   I  FF  +  +   S  N + +M YN+ 
Sbjct: 794 LILVHGRYSYNRTAFLSQ---YSFYKSLLICFIQIFFSFISGVSGTSLFNSVSLMAYNVF 850

Query: 258 LTA 250
            T+
Sbjct: 851 YTS 853


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,232,108
Number of Sequences: 28952
Number of extensions: 258512
Number of successful extensions: 412
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 402
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 412
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1412971776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)