BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40226 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 27 0.48 AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transpor... 27 0.64 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 27 0.64 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 25 2.0 AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 2.0 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 24 3.4 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 24 3.4 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 24 4.5 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 24 4.5 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 24 4.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.0 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 27.1 bits (57), Expect = 0.48 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -2 Query: 323 AP*YRPSYGISCRLVPCHQ*GFPSGCYTPKDLLSDGNVYDSTSTLDN 183 +P +RP C L H G P+ T K +SD +++T+T DN Sbjct: 336 SPQFRPGLPFKCALQFTHHDGTPAKGITGKVEVSDVG-FETTTTSDN 381 >AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transporter protein. Length = 156 Score = 26.6 bits (56), Expect = 0.64 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 Query: 44 CLWLEEHPG 70 CLWL+EHPG Sbjct: 46 CLWLQEHPG 54 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 26.6 bits (56), Expect = 0.64 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 Query: 44 CLWLEEHPG 70 CLWL+EHPG Sbjct: 460 CLWLQEHPG 468 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 259 SQADATRPRICSPTG 215 SQ+D TRP I SPTG Sbjct: 30 SQSDPTRPIIDSPTG 44 >AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 358 MQTGIKAVDSLVPIGRGQR 414 +QTGI A+D + I RGQ+ Sbjct: 5 IQTGISAIDVMNSIARGQK 23 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 24.2 bits (50), Expect = 3.4 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = +3 Query: 57 KNIQAEEMVEFSSGLKGMALNLEPDNVGVVVFGNDKLIKEGDIVKRTG 200 KN E+ EFS PDN+ V + G D GD R G Sbjct: 257 KNALPEQ--EFSKSFSTFGFVWTPDNITVSINGEDLATIGGDFWTRGG 302 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 24.2 bits (50), Expect = 3.4 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = +3 Query: 57 KNIQAEEMVEFSSGLKGMALNLEPDNVGVVVFGNDKLIKEGDIVKRTG 200 KN E+ EFS PDN+ V + G D GD R G Sbjct: 257 KNALPEQ--EFSKSFSTFGFVWTPDNITVSINGEDLATIGGDFWTRGG 302 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 4.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 72 QPGCSSSHKHERYHHQCSRHDQ 7 +P S+ H+H HH R ++ Sbjct: 20 EPSASTKHRHHSRHHHRRRRER 41 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 4.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 72 QPGCSSSHKHERYHHQCSRHDQ 7 +P S+ H+H HH R ++ Sbjct: 20 EPSASTKHRHHSRHHHRRRRER 41 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 4.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 72 QPGCSSSHKHERYHHQCSRHDQ 7 +P S+ H+H HH R ++ Sbjct: 20 EPSASTKHRHHSRHHHRRRRER 41 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/27 (40%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -1 Query: 90 RTPPS-PQPGCSSSHKHERYHHQCSRH 13 R PPS + +SSH H HH H Sbjct: 1299 RLPPSRSEDTLNSSHLHHHLHHGHHHH 1325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,467 Number of Sequences: 2352 Number of extensions: 14179 Number of successful extensions: 53 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -