BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40225 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.3 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 4.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.3 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 9.9 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 9.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 94 PHPRLQRSPCRLLRNPSRGQPGP 162 PHP L P L +P+ PGP Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 94 PHPRLQRSPCRLLRNPSRGQPGP 162 PHP L P L +P+ PGP Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGP 146 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 428 PSKPSVLSNSSTGVQPVSRSVSTTSHP 348 P+KPS S+T + STT+ P Sbjct: 1169 PTKPSYRPPSTTNHWQTKTTTSTTTRP 1195 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 491 WLAVCCTVVTSYPRM 447 W VC VV YPR+ Sbjct: 166 WREVCTFVVQVYPRL 180 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 525 LVGGLEACVCDLG 563 L+GG +C CDLG Sbjct: 703 LMGGKWSCDCDLG 715 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 20.6 bits (41), Expect = 9.9 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = +1 Query: 49 SAP*KIFHWLSTLRLPHPRLQRSPCRLLRNPSRGQPGPHGLRRTLPPPYPHR 204 ++P K ++ L T P + + R + P + PPYP+R Sbjct: 440 NSPTKPYYKLKTANNKRPPSTELGTNIYTSSKRQRTSPQLSPMSSLPPYPNR 491 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -2 Query: 177 SPKPVRTWLPSRRITKKSAWTPLKA 103 S K V+ W +RR+ K P A Sbjct: 157 SEKQVKIWFQNRRVKYKKEDLPAAA 181 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 506 VMASTWLAVCCT 471 ++AST L +CCT Sbjct: 1356 ILASTELNLCCT 1367 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 506 VMASTWLAVCCT 471 ++AST L +CCT Sbjct: 1356 ILASTELNLCCT 1367 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 506 VMASTWLAVCCT 471 ++AST L +CCT Sbjct: 1356 ILASTELNLCCT 1367 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 506 VMASTWLAVCCT 471 ++AST L +CCT Sbjct: 1356 ILASTELNLCCT 1367 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,842 Number of Sequences: 336 Number of extensions: 3291 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -