Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40222
         (662 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_1186 + 25027498-25029854,25029953-25030564,25031742-250318...    28   5.8  

>08_02_1186 + 25027498-25029854,25029953-25030564,25031742-25031847,
            25032669-25033199
          Length = 1201

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 6/44 (13%)
 Frame = -1

Query: 452  PVHHKRYTDDRRMKRS*LYLRLCDASF------LPFPVCASPTN 339
            P  H RY  ++RM R  L    C+  +       PF VCA P++
Sbjct: 971  PPQHSRYYKNKRMPRGTLLGLFCEPGYGASGVPTPFSVCARPSD 1014


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,610,377
Number of Sequences: 37544
Number of extensions: 313352
Number of successful extensions: 498
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 493
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 498
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1667659452
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)