BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40221 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 7.5 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 23 9.9 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 9.9 >AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 408 GGCRRKCLSILKTIREPPLGLAG*PGDVLSHEDVLLYECEKH 533 G CL L +P + P L+ + L Y+CEKH Sbjct: 88 GSMENVCL-FLNLANDPTIERIITPRLALTAAEFLAYQCEKH 128 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 14 LGRVHHRFGIPIGAQDTVALP 76 LG + RFG+P+ TV LP Sbjct: 172 LGFFNRRFGVPLIDGGTVRLP 192 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 511 CCTSARNTRGSTSGTRPPSA 570 CC S N G+ S PP+A Sbjct: 144 CCCSGDNCNGNFSYLPPPTA 163 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,526 Number of Sequences: 2352 Number of extensions: 14667 Number of successful extensions: 29 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -