BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40221 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.0 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 22 5.3 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 5.3 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 9.2 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 190 PRRSSAPACGAGPPHTGP 243 P+R S P GPP GP Sbjct: 34 PQRGSPPNPSQGPPPGGP 51 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 24 FITASGYLSARKIRSRFQTLVAQACDKCSY 113 F SGY S R+ + + +C KC Y Sbjct: 19 FDKCSGYPSIRQGTTSYCLGCGDSCHKCKY 48 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 123 RNLYTSTCHRPELPTFGSATVSCAPIGIPK 34 +N+ S +P+L FGS+ + AP I K Sbjct: 184 KNILMSKNGQPKLTDFGSSVLIGAPNEIDK 213 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 125 ENDRGNNRSQVANS*KIH 178 +ND N +QV +S K+H Sbjct: 527 QNDNNRNDNQVHHSSKLH 544 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,369 Number of Sequences: 438 Number of extensions: 4869 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -