BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40220 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 31 0.78 SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) 29 3.1 SB_14150| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 28 5.5 SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) 28 7.2 SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) 28 7.2 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 31.1 bits (67), Expect = 0.78 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +1 Query: 322 IFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTA 471 I + G ++ E +H S+F +Y+LP + V++ +T DG L + A Sbjct: 64 IKIDGKHKS-EGEHGYETSEFHRSYNLPDGVDVSTVSSRITGDGLLHIEA 112 >SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) Length = 405 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -2 Query: 241 SVDSWPDVHKSGDQLPQRSKQTEWRKVQPWEREL--VICNGDGCAITSLSRAGKAVTVAK 68 +V S+ + KSG +P R++ T +R PW +E+ ++C D +T ++ TV Sbjct: 135 AVSSYRFLCKSGHYIPLRTRSTLFR--NPWTKEIEFLVCTND--VLTEFDLPPQSNTVVV 190 Query: 67 PAKAMK 50 P + + Sbjct: 191 PPTSQR 196 >SB_14150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 584 GFYCRLFYRLVLLVRSASLDNRYNAPVFFVLSTFSLIGA 468 G+ CRL RLV +VR + Y V +L+ F L+ A Sbjct: 238 GYDCRLRVRLVRIVRKFDRYSEYGQAVIILLTCFFLLVA 276 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 334 GSQEAKEDDHDVFASQFFHTYSLPVNSSAA 423 G+ +E+D DV+A Y +P N SAA Sbjct: 245 GTGVFEEEDDDVYAQDIMSNYDIPKNISAA 274 >SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) Length = 444 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 116 APVSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGP 229 +P + T DQ + + + SPFS APL P FVD P Sbjct: 220 SPETFTSDQLSPTYSSPSPFSSKAPL----PVFVDFTP 253 >SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) Length = 275 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 234 ILGPMSTKVGISFHKGANRLNGERFSH 154 + G T+VGI H G NR+ + F H Sbjct: 209 VAGEKKTEVGIKIHSGRNRIVRKIFEH 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,894,243 Number of Sequences: 59808 Number of extensions: 294072 Number of successful extensions: 887 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -