BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40219 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 27 0.58 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.4 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 26 1.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 4.1 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 5.4 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 7.2 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 7.2 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 7.2 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 9.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 9.5 AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 23 9.5 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 27.1 bits (57), Expect = 0.58 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +2 Query: 389 RHRCQRYPQRFRYR-EVHQQGEQDHHYQRQRSSLQGRDRAYVNEAXKYRNEDDKQR*PSR 565 + R Q+ QR + + + HQ+ +Q QRQ+ Q + + + +N +Q+ ++ Sbjct: 270 QQREQQQQQRVQQQNQQHQRQQQQQQQQRQQQQQQEQQELWTTVVRRRQNTQQQQQ-SNQ 328 Query: 566 PRMHWNLTG 592 P+ TG Sbjct: 329 PQQQQQQTG 337 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 401 QRYPQRFRYREVHQQGEQDHHYQRQR 478 QR PQR+ QQ +Q H Q+Q+ Sbjct: 354 QRQPQRYVVAGSSQQQQQQHQQQQQK 379 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 386 LRHRCQRYPQRFRYREVHQQGEQDHHYQRQRS 481 L+ + Q+ Q+ + + HQQ + HH+Q Q S Sbjct: 1308 LQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLS 1339 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.8 bits (54), Expect = 1.4 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +2 Query: 389 RHRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYVNEAXKYRNEDDKQR*PSRP 568 + R Q+ Q+ R ++ QQ +Q QRQ+ Q + + + + +Q+ +P Sbjct: 320 QQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQP 379 Query: 569 R 571 R Sbjct: 380 R 380 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +2 Query: 422 RYREVHQQGEQDHHYQRQRSSLQGRDRAYVNEAXKYRNEDDKQR 553 R ++ HQQ +Q QRQ+ Q + + + + + + +Q+ Sbjct: 306 RQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQ 349 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 4.1 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +2 Query: 437 HQQGEQDHHYQRQRSSLQGRDRAYVNEAXKYRNEDDK 547 HQ + DH + SLQ D A + ++N K Sbjct: 1169 HQDNKLDHELNHRGVSLQDDDTASIKSYGSHKNRPFK 1205 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 357 PRGVPQIEVTFDIDANGILNVSAIEKSTNKE--NKITITNDKGRLS 488 P G + T+D+ +G+LN A+ N + I I D G L+ Sbjct: 255 PDGFMALVDTYDVKRSGLLNFCAVALGLNDQGYRAIGIRIDSGDLA 300 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 401 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 487 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 401 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 487 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 401 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 487 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRQPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 401 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 487 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRPPQQFQQQQRQPQYLQPQQLQRQQEEL 216 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 401 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 487 QR PQ F+ ++ Q Q QRQ+ L Sbjct: 260 QRQPQEFQQQQRQPQYLQPQQSQRQQEEL 288 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +3 Query: 357 PRGVPQIEVTFDIDANGILNVSAIEK---STNKENKITITN 470 P+G + ++ + ++GIL ++ K N+E I IT+ Sbjct: 65 PKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITH 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,425 Number of Sequences: 2352 Number of extensions: 12612 Number of successful extensions: 45 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -