BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40218 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 2.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 2.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 3.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 3.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 3.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 3.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 3.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 3.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 3.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.8 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 6.3 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 6.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 6.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.4 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ I + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPIPVPV 125 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N ++V + + V Sbjct: 97 NNNNYNNYKKLYYNINYIEQVPVPIPV 123 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +3 Query: 306 FEASNNTHSNYLKLLENFKVGDEVSISMEV 395 + +NN ++NY KL N +++ + + V Sbjct: 104 YNYNNNNYNNYKKLYYNINYIEQIPVPVPV 133 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDEVSISMEV 395 +NN ++NY KL N +++ + + V Sbjct: 99 NNNNYNNYKKLYYNINYIEQIPVPVPV 125 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 303 YFEASNNTHSNYLKLLENFKVGDEVSISMEV 395 Y +NN ++NY KL N +++ + + V Sbjct: 337 YNNYNNNYNNNYKKLYYNINYIEQIPVPVPV 367 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDE 374 +NN ++NY KL +N+ + E Sbjct: 106 NNNYNNNYKKLYKNYIINIE 125 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 315 SNNTHSNYLKLLENFKVGDE 374 +NN ++NY KL +N+ + E Sbjct: 106 NNNYNNNYKKLYKNYIINIE 125 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 492 ENGNGPSALRTNSATNITCATETG 563 +NGNG A N+ ++ C T G Sbjct: 256 DNGNGNGASNNNNNGDMFCHTGLG 279 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 303 YFEASNNTHSNYLKLLENFKVGDEVSISMEV 395 Y +NN ++NY KL N +++ + + V Sbjct: 338 YNNYNNNNYNNYKKLYYNIINIEQIPVPVPV 368 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.4 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +1 Query: 466 STAKWSRTSRTETDLPRYVQTQQQTLPVRRKLAQDSRREISVRG 597 ST +W TS T Q QQQ +++ Q S + + G Sbjct: 777 STTRWPATSVITTTTGARQQQQQQQQQQQQQQQQQSSSDYLMVG 820 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,632 Number of Sequences: 438 Number of extensions: 3339 Number of successful extensions: 22 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -