BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40216 (831 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11670.1 68417.m01865 expressed protein contains Pfam PF05664... 30 2.2 At4g26620.1 68417.m03836 sucrase-related 28 8.7 >At4g11670.1 68417.m01865 expressed protein contains Pfam PF05664: Protein of unknown function (DUF810) Length = 985 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -1 Query: 807 LFLYNIPSTFTALQ-VLSLIYHILHTYNKLVF 715 LF ++P T LQ +LSLIYH L TY + VF Sbjct: 598 LFGLHLPVDITHLQALLSLIYHSLDTYLQRVF 629 >At4g26620.1 68417.m03836 sucrase-related Length = 443 Score = 27.9 bits (59), Expect = 8.7 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -1 Query: 756 LIYHILHTYNKLVFFSTLEIPLEILYMAKQCLPGQLVLYKNELLFVSLAKSRERLDG 586 LI+ + Y +L F E+L + LPG L K +FV SR+R G Sbjct: 146 LIFPDMIRYRRLTHFDVETFVEEVLVKDGEWLPGNPELLKGSYVFVCSHGSRDRRCG 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,870,285 Number of Sequences: 28952 Number of extensions: 304118 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -