BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40213 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 47 5e-07 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 8.4 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 47.2 bits (107), Expect = 5e-07 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = +2 Query: 98 LFCTDVASRGLDIPAVDWIVQFDPPGDANEYIHRVGRPARGLGADGNA 241 L T VA+RGLDI V+ +V +D P ++Y+HR+GR R +G G A Sbjct: 477 LIATSVAARGLDIKNVNHVVNYDLPKSIDDYVHRIGRTGR-VGNKGRA 523 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 120 DATSVQNKGYIFWFHRI 70 DA Q GY+ W HR+ Sbjct: 900 DAAGHQASGYVRWAHRL 916 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,224 Number of Sequences: 2352 Number of extensions: 15829 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -