BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40212 (670 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC320.08 |||membrane transporter |Schizosaccharomyces pombe|ch... 26 5.6 SPCC1739.03 |hrr1||Helicase Required for RNAi-mediated heterochr... 25 9.9 >SPCC320.08 |||membrane transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 505 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 481 ITLYSSVCTVSHTFLSRV*HLKLLPWKKEEG 573 ++LY S+ ++ TF+ HL L W E G Sbjct: 331 LSLYGSIISIIQTFIFDRHHLYTLHWTSEMG 361 >SPCC1739.03 |hrr1||Helicase Required for RNAi-mediated heterochromatin assembly Hrr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1015 Score = 25.0 bits (52), Expect = 9.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 457 LNEILFLK*MNANRTRRKVASVDGAKGTEHQMN*IDLVR 341 L E L + +N + KVA+VDG +G E+ + + LVR Sbjct: 871 LIERLLSESLNREKHFIKVATVDGYQGEENDVVLLSLVR 909 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,518,373 Number of Sequences: 5004 Number of extensions: 49126 Number of successful extensions: 141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -