BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40212 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 28 7.9 >SB_2422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 581 TDGPSSFFHGNSFKCYTRDKNV*ETVQTDE 492 TDGPS +FH FK + D V TV+ DE Sbjct: 63 TDGPSCYFHKEIFKAFP-DSKVILTVRKDE 91 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +2 Query: 80 FMSVPHLASARQTFWWKPISNRE-LVALRN*SLVCLVIIALRWKTGSLFVLHKQLATTHA 256 F +V H+A+A +T + SNR+ +A VC V+ L S F+ + T + Sbjct: 371 FTTVGHIATANKTTSNRQTSNRQNAIAPDAMRRVCRVLSMLALSPSSHFLYRTRFTTPNR 430 Query: 257 MLRKGPP 277 ++ PP Sbjct: 431 IVSTHPP 437 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,490,356 Number of Sequences: 59808 Number of extensions: 357016 Number of successful extensions: 707 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -