BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40204 (833 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 3.9 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.1 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 637 NTSSFNSPQSSTAGHRPLPIRTTEP 711 N +F +P +STA RP I P Sbjct: 32 NVPNFAAPSTSTAVQRPQAILQVRP 56 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/42 (19%), Positives = 24/42 (57%) Frame = -2 Query: 403 SITLIDVCQVILKSTTSLAVLNTMTALVLTYNCCHRNLDWID 278 S+ + +C+++++ TTS+ ++N + ++ + WI+ Sbjct: 417 SLAIFVLCELLIEGTTSI-LINVPSLIIHVSTSAYVATVWIN 457 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,535 Number of Sequences: 336 Number of extensions: 4565 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22932949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -