BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40204 (833 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 29 0.13 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 2.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.7 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 8.7 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 8.7 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 29.5 bits (63), Expect = 0.13 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 683 GLSQSAPLSPVCGSPHPLLAGH-PVEVMHHLARGASHGYGLPVRV 814 G Q P +CG+ +P+L GH ++ + ++ S GLP+ V Sbjct: 7 GARQILPEDSLCGASYPILNGHTTIQGLIEMSTSGSGSSGLPLLV 51 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 25.0 bits (52), Expect = 2.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 655 SPQSSTAGHRPLPIRTTEPGLRLSSSTSC 741 SP ++ LP+R P + L+SS+SC Sbjct: 164 SPAAAVRSDSSLPMRHYVPHISLNSSSSC 192 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 319 LTYNCCHRNLDWIDEGASEN 260 LTY+ H+ + IDE S+N Sbjct: 2296 LTYHTFHKEIKGIDEAKSKN 2315 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 84 LFALCLLYVFFVNTYVDIVSG 22 LF LC ++ +++TYV ++ G Sbjct: 258 LFKLCQMFSLYLSTYVLVLVG 278 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 84 LFALCLLYVFFVNTYVDIVSG 22 LF LC ++ +++TYV ++ G Sbjct: 259 LFKLCQMFSLYLSTYVLVLVG 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,153 Number of Sequences: 2352 Number of extensions: 17994 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -