BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40204 (833 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.6 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 6.1 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 6.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 733 TSCRPPCGGHAPPSQG 780 ++ R P GG PPS G Sbjct: 399 SAVRSPAGGQLPPSAG 414 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +2 Query: 41 YVFTKNTYKRQRANKPVYHTNVCLKWESNPRPSP 142 Y + N Y NK +Y+ + ++ P P P Sbjct: 96 YNYNNNNYNNNNYNKKLYYNIINIEQIPVPVPVP 129 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +2 Query: 41 YVFTKNTYKRQRANKPVYHTNVCLKWESNPRPSP 142 Y + N Y NK +Y+ + ++ P P P Sbjct: 96 YNYNNNNYNNNNYNKKLYYNIINIEQIPVPVPVP 129 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 6.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 126 THVPRHSNQGRLLQHQRVSHD 188 +HV R G L HQR S D Sbjct: 4 SHVVRGIEHGGLYYHQRCSRD 24 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,467 Number of Sequences: 438 Number of extensions: 5086 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -