BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40202 (831 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 26 0.42 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 3.9 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 25.8 bits (54), Expect = 0.42 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 693 GSWIKENLNIN----HMIPILLDLKLTAIGDMHYGH 788 G W ++NLN N H I D + AIG YGH Sbjct: 224 GEWQRDNLNANSSITHWILSGADPQKLAIGIAFYGH 259 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -2 Query: 443 KCMIKTIKLVLIISHLVNKITIL 375 KC+ T+K++ I+++LV + +L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -2 Query: 443 KCMIKTIKLVLIISHLVNKITIL 375 KC+ T+K++ I+++LV + +L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -2 Query: 443 KCMIKTIKLVLIISHLVNKITIL 375 KC+ T+K++ I+++LV + +L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -2 Query: 443 KCMIKTIKLVLIISHLVNKITIL 375 KC+ T+K++ I+++LV + +L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 520 NHKFVLIKVKYMKQYLYEKMVC 585 NH + + K++ QYL E++VC Sbjct: 89 NHPHIQLP-KHVDQYLLEQLVC 109 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,789 Number of Sequences: 336 Number of extensions: 4512 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22829180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -