BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40200 (835 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ... 142 2e-34 At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E... 87 1e-17 At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E... 87 1e-17 At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E... 87 1e-17 At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E... 86 3e-17 At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro... 85 4e-17 At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)... 79 3e-15 At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ... 79 4e-15 At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ... 79 5e-15 At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ... 79 5e-15 At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)... 78 8e-15 At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)... 78 8e-15 At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E... 78 8e-15 At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E... 78 8e-15 At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E... 78 8e-15 At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)... 77 1e-14 At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ... 77 2e-14 At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ... 76 3e-14 At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ... 76 3e-14 At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)... 76 3e-14 At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative ... 75 4e-14 At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E... 74 1e-13 At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ... 74 1e-13 At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) id... 73 2e-13 At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ... 72 4e-13 At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative ... 71 7e-13 At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative ... 71 7e-13 At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E... 71 1e-12 At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)... 70 2e-12 At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative ... 70 2e-12 At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative ... 67 2e-11 At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ... 66 2e-11 At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)... 66 4e-11 At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ... 62 3e-10 At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18)... 61 8e-10 At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17)... 61 8e-10 At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)... 60 2e-09 At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15)... 58 5e-09 At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative ... 58 7e-09 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 56 2e-08 At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family pro... 55 5e-08 At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative ... 50 1e-06 At2g18600.1 68415.m02166 RUB1-conjugating enzyme, putative stron... 50 1e-06 At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative ... 50 1e-06 At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family pro... 50 3e-06 At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E... 49 4e-06 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 48 1e-05 At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro... 47 1e-05 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 47 1e-05 At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 46 2e-05 At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ... 45 7e-05 At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E... 42 4e-04 At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family pro... 38 0.008 At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family pro... 38 0.011 At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family pro... 33 0.18 At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family pro... 33 0.23 >At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative strong similarity to SP|P50550 Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 160 Score = 142 bits (345), Expect = 2e-34 Identities = 59/85 (69%), Positives = 68/85 (80%) Frame = +1 Query: 256 SLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCL 435 ++NLM W C IPGK GT WEGG + L M F +DYPS PPKCKF FHPNVYPSGTVCL Sbjct: 36 TVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCL 95 Query: 436 SLLDEEKDWRPAITIKQILLGIQDL 510 S+L+E+ WRPAIT+KQIL+GIQDL Sbjct: 96 SILNEDYGWRPAITVKQILVGIQDL 120 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +2 Query: 158 SGIASARLAEERKAWRKDHPFGFVARPMKNPD 253 SGIA RLAEERK+WRK+HP GFVA+P D Sbjct: 3 SGIARGRLAEERKSWRKNHPHGFVAKPETGQD 34 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 480 KANFVGYSRSLNEPNVKDPAQAEAYTIYCQNRLEYDK 590 K VG L+ PN DPAQ + Y ++CQ+ +EY K Sbjct: 111 KQILVGIQDLLDTPNPADPAQTDGYHLFCQDPVEYKK 147 >At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2; identical to gi:2689242, SP:P42745 Length = 152 Score = 87.4 bits (207), Expect = 1e-17 Identities = 35/83 (42%), Positives = 49/83 (59%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+M W I G TPW+GG +KL + F +DYP+ PP +F +FHPN+Y G++CL + Sbjct: 32 NIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDI 91 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L + W P + IL IQ L Sbjct: 92 L--QNQWSPIYDVAAILTSIQSL 112 >At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 87.4 bits (207), Expect = 1e-17 Identities = 35/83 (42%), Positives = 49/83 (59%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+M W I G TPW+GG +KL + F +DYP+ PP +F +FHPN+Y G++CL + Sbjct: 32 NIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDI 91 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L + W P + IL IQ L Sbjct: 92 L--QNQWSPIYDVAAILTSIQSL 112 >At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 87.4 bits (207), Expect = 1e-17 Identities = 35/83 (42%), Positives = 49/83 (59%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+M W I G TPW+GG +KL + F +DYP+ PP +F +FHPN+Y G++CL + Sbjct: 32 NIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDI 91 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L + W P + IL IQ L Sbjct: 92 L--QNQWSPIYDVAAILTSIQSL 112 >At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2; identical to gi:431261, SP:P42746 Length = 150 Score = 85.8 bits (203), Expect = 3e-17 Identities = 34/83 (40%), Positives = 50/83 (60%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+M W I G + TPW+GG +KL + F +DYP+ PP +F +FHPN+Y G++CL + Sbjct: 32 NIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDI 91 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L + W P + +L IQ L Sbjct: 92 L--QNQWSPIYDVAAVLTSIQSL 112 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 510 LNEPNVKDPAQAEAYTIYCQNRLEYDK 590 L +PN PA AEA ++ +N+ EY++ Sbjct: 113 LCDPNPDSPANAEAARLFSENKREYNR 139 >At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family protein similar to Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 154 Score = 85.4 bits (202), Expect = 4e-17 Identities = 33/82 (40%), Positives = 54/82 (65%) Frame = +1 Query: 256 SLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCL 435 S N+ W I G GTP+EGG++ L + F DYP PPK F+ P++HPN+ G++C+ Sbjct: 33 SNNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICM 92 Query: 436 SLLDEEKDWRPAITIKQILLGI 501 ++L ++ W PA+ ++++LL I Sbjct: 93 NILKDK--WTPALMVEKVLLSI 112 >At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20) nearly identical to ubiquitin-conjugating enzyme UBC20 [Arabidopsis thaliana] GI:22530867; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 180 Score = 79.4 bits (187), Expect = 3e-15 Identities = 37/83 (44%), Positives = 49/83 (59%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ W+ I G K T +EG Y+L + F +DYP PPK KFE FHPNV G +CL + Sbjct: 63 NIFCWKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKVKFETCCFHPNVDVYGNICLDI 122 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L ++ W A ++ ILL IQ L Sbjct: 123 LQDK--WSSAYDVRTILLSIQSL 143 >At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative identical or nearly so to Ubiquitin-conjugating enzymes SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 79.0 bits (186), Expect = 4e-15 Identities = 33/83 (39%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPNV +G++CL + Sbjct: 29 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 178 Score = 78.6 bits (185), Expect = 5e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 59 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 118 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 119 LKEQ--WSPALTISKVLLSICSL 139 >At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 148 Score = 78.6 bits (185), Expect = 5e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 77.8 bits (183), Expect = 8e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 77.8 bits (183), Expect = 8e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 149 Score = 77.8 bits (183), Expect = 8e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 30 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 89 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 90 LKEQ--WSPALTISKVLLSICSL 110 >At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 77.8 bits (183), Expect = 8e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 77.8 bits (183), Expect = 8e-15 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11) E2; identical to gi:12643427, SP:P35134 Length = 148 Score = 77.0 bits (181), Expect = 1e-14 Identities = 31/83 (37%), Positives = 52/83 (62%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F+ ++HPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+TI ++LL I L Sbjct: 89 LKEQ--WSPALTISKVLLSICSL 109 >At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative strong similarity to SP|P35133 Ubiquitin-conjugating enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 76.6 bits (180), Expect = 2e-14 Identities = 31/83 (37%), Positives = 50/83 (60%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G +CL + Sbjct: 29 DMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L ++ W PA+TI ++LL I L Sbjct: 89 LKDQ--WSPALTISKVLLSICSL 109 >At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 76.2 bits (179), Expect = 3e-14 Identities = 30/83 (36%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F ++HPN+ +G++CL + Sbjct: 29 DMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+T+ ++LL I L Sbjct: 89 LKEQ--WSPALTVSKVLLSICSL 109 >At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 76.2 bits (179), Expect = 3e-14 Identities = 30/83 (36%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F ++HPN+ +G++CL + Sbjct: 29 DMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA+T+ ++LL I L Sbjct: 89 LKEQ--WSPALTVSKVLLSICSL 109 >At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19) nearly identical to ubiquitin-conjugating enzyme UBC19 [Arabidopsis thaliana] GI:22530865; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 181 Score = 76.2 bits (179), Expect = 3e-14 Identities = 36/83 (43%), Positives = 48/83 (57%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ W+ I G K T +EG Y+L + F +DYP PK KFE FHPNV G +CL + Sbjct: 64 NIFCWKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDI 123 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L ++ W A ++ ILL IQ L Sbjct: 124 LQDK--WSSAYDVRTILLSIQSL 144 >At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin conjugating enzyme [Lycopersicon esculentum] GI:886679; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 192 Score = 75.4 bits (177), Expect = 4e-14 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 1/84 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLS 438 NL IPG GTP+EGG +++ + D YP PPK +F ++HPN+ SG +CL Sbjct: 31 NLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAICLD 90 Query: 439 LLDEEKDWRPAITIKQILLGIQDL 510 +L ++ W PA+T+K L+ IQ L Sbjct: 91 ILKDQ--WSPALTLKTALVSIQAL 112 >At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 145 Score = 74.1 bits (174), Expect = 1e-13 Identities = 30/81 (37%), Positives = 49/81 (60%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F +FHPN+ +G++CL + Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 442 LDEEKDWRPAITIKQILLGIQ 504 L E+ W PA+TI ++ L Q Sbjct: 89 LKEQ--WSPALTISKVTLIFQ 107 >At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative strong similar to ubiquitin-conjugating enzymes E2-17 from [Arabidopsis thaliana] SP|P35134, SP|P35132, SP|P35133; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 149 Score = 74.1 bits (174), Expect = 1e-13 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 ++ W+ I G +P+ GG++ + + F DYP PPK F+ ++HPN+ G++CL + Sbjct: 30 DIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSICLDI 89 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L E+ W PA T ++LL I L Sbjct: 90 LKEQ--WSPAPTTSKVLLSICSL 110 >At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) identical to ubiquitin-conjugating enzyme COP10 [Arabidopsis thaliana] GI:20065779; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 182 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/83 (39%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 NL W I G GTP+EGG++ L +IF DYP PPK F+ ++H NV +G + +++ Sbjct: 64 NLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNI 123 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L + W PA+TI ++L I+ + Sbjct: 124 LRD--SWSPALTITKVLQAIRSI 144 >At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) {Homo sapiens}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 251 Score = 72.1 bits (169), Expect = 4e-13 Identities = 30/72 (41%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = +1 Query: 280 CA-IPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEK 456 CA I G GTP+E GL+++++ D+P SPPK F +FHPNV +G +C++ L +K Sbjct: 43 CADIEGPVGTPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHPNVASNGEICVNTL--KK 100 Query: 457 DWRPAITIKQIL 492 DW P++ ++ +L Sbjct: 101 DWNPSLGLRHVL 112 >At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 71.3 bits (167), Expect = 7e-13 Identities = 30/83 (36%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ + I G +P+EGG++KL + ++YP + PK +F ++HPN+ G +CL + Sbjct: 33 NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 92 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L ++ W PA+ I+ +LL IQ L Sbjct: 93 LKDK--WSPALQIRTVLLSIQAL 113 >At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 71.3 bits (167), Expect = 7e-13 Identities = 30/83 (36%), Positives = 51/83 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ + I G +P+EGG++KL + ++YP + PK +F ++HPN+ G +CL + Sbjct: 33 NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 92 Query: 442 LDEEKDWRPAITIKQILLGIQDL 510 L ++ W PA+ I+ +LL IQ L Sbjct: 93 LKDK--WSPALQIRTVLLSIQAL 113 >At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2; identical to gi:992703, SP:P42747 Length = 198 Score = 70.5 bits (165), Expect = 1e-12 Identities = 42/122 (34%), Positives = 56/122 (45%), Gaps = 11/122 (9%) Frame = +1 Query: 169 KCTFS*RTESLA*GPSLWFCREAYEESRCSLNLMTWECAIPGKKGTPWEGGLYKLRMIFK 348 K FS R S A S W +S N+ W I G T +EGG + M F Sbjct: 37 KLAFSFRNNSKA---SPWNLSPYQNQSCDCYNIFEWSVTIIGPPDTLYEGGFFNAIMTFP 93 Query: 349 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD-----------WRPAITIKQILL 495 +YP+SPP +F ++HPNVY G VC+S+L D W P T++ I+L Sbjct: 94 QNYPNSPPTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIML 153 Query: 496 GI 501 I Sbjct: 154 SI 155 >At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13) E2; identical to gi:992706 Length = 166 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 11/91 (12%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ W I G T +EGG + M F +YP+SPP +F ++HPNVYP G VC+S+ Sbjct: 33 NIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPNVYPDGRVCISI 92 Query: 442 LDEEKD-----------WRPAITIKQILLGI 501 L D W P T++ I+L I Sbjct: 93 LHPPGDDPSGYELASERWTPVHTVESIMLSI 123 >At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 120 Score = 69.7 bits (163), Expect = 2e-12 Identities = 29/75 (38%), Positives = 48/75 (64%) Frame = +1 Query: 286 IPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWR 465 I G +P+EGG++KL + ++YP + PK +F ++HPN+ G +CL +L ++ W Sbjct: 8 ILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDK--WS 65 Query: 466 PAITIKQILLGIQDL 510 PA+ I+ +LL IQ L Sbjct: 66 PALQIRTVLLSIQAL 80 >At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 112 Score = 66.9 bits (156), Expect = 2e-11 Identities = 27/78 (34%), Positives = 48/78 (61%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ + I G +P+EGG++KL + ++YP + PK +F ++HPN+ G +CL + Sbjct: 33 NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 92 Query: 442 LDEEKDWRPAITIKQILL 495 L ++ W PA+ I+ +LL Sbjct: 93 LKDK--WSPALQIRTVLL 108 >At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) {Pichia angusta}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 157 Score = 66.5 bits (155), Expect = 2e-11 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLS 438 N+ W I G TP+EGG+++L + YP PP+ +F +FHPNV + +G +CL Sbjct: 33 NIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLD 92 Query: 439 LLDEEKDWRPAITIKQILLGI 501 +L + W PA T++ + I Sbjct: 93 IL--KNAWSPAWTLQSVCRAI 111 >At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14) E2; UbcAT3; identical to gi:2129757, S46656 Length = 167 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/91 (36%), Positives = 46/91 (50%), Gaps = 11/91 (12%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ W +I G T +EGG + M F ++YP SPP F ++HPNVY G VC+S+ Sbjct: 34 NVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKVCISI 93 Query: 442 LDEEKD-----------WRPAITIKQILLGI 501 L D W P T++ I+L I Sbjct: 94 LHPPGDDPHGYELASERWTPVHTVESIVLSI 124 >At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme from [Oryza sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134, SP|P35131; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 177 Score = 62.5 bits (145), Expect = 3e-10 Identities = 27/80 (33%), Positives = 42/80 (52%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ WE + G G P+E G++ + + YP PPK F+ +FHPN+ G + + + Sbjct: 58 NIFRWEATVNGPVGCPYEKGVFTVSVHIPPKYPYEPPKITFKTKIFHPNISEIGEIFVDI 117 Query: 442 LDEEKDWRPAITIKQILLGI 501 L W A+TI +LL I Sbjct: 118 LGSR--WSSALTINLVLLSI 135 >At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18) E2; identical to gi:2801448 Length = 161 Score = 61.3 bits (142), Expect = 8e-10 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 1/91 (1%) Frame = +1 Query: 250 RCSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPL-FHPNVYPSGT 426 R + NL W + G GT + Y L++ F YP P+ F PP HP++Y +G Sbjct: 38 RVTDNLQKWVIEVTGAPGTLYANETYNLQVEFPQHYPMEAPQVIFVPPAPLHPHIYSNGH 97 Query: 427 VCLSLLDEEKDWRPAITIKQILLGIQDLSMS 519 +CL +L + W PA+T+ + + I + S Sbjct: 98 ICLDILYD--SWSPAMTVSSVCISILSMLSS 126 >At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17) E2; identical to gi:2801446 Length = 161 Score = 61.3 bits (142), Expect = 8e-10 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 1/108 (0%) Frame = +1 Query: 250 RCSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPL-FHPNVYPSGT 426 R S NL W + G GT + Y+L++ F + YP P+ F+ P HP++Y +G Sbjct: 38 RVSDNLQRWIIEVHGVPGTLYANETYQLQVEFPEHYPMEAPQVIFQHPAPLHPHIYSNGH 97 Query: 427 VCLSLLDEEKDWRPAITIKQILLGIQDLSMSLT*KIQRKLKPTQFIVK 570 +CL +L + W PA+ + I L I LSM + +++K K +K Sbjct: 98 ICLDVLYD--SWSPAMRLSSICLSI--LSMLSSSSVKQKPKDNDHYLK 141 >At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16) E2; identical to gi:2801444, GB:AAC39325 from [Arabidopsis thaliana] (Plant Mol. Biol. 23 (2), 387-396 (1993)) Length = 161 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 1/91 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKF-EPPLFHPNVYPSGTVCLS 438 NL W + G GT + Y+L++ F + YP P+ F P HP++Y +G +CL Sbjct: 42 NLQRWIIEVIGAPGTLYANDTYQLQVDFPEHYPMESPQVIFLHPAPLHPHIYSNGHICLD 101 Query: 439 LLDEEKDWRPAITIKQILLGIQDLSMSLT*K 531 +L + W PA+T+ I + I + S T K Sbjct: 102 ILYD--SWSPAMTVSSICISILSMLSSSTEK 130 >At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15) E2; identical to ubiquitin-conjugating enzyme 15 GI:2801442 from [Arabidopsis thaliana] Length = 161 Score = 58.4 bits (135), Expect = 5e-09 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 1/87 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKF-EPPLFHPNVYPSGTVCLS 438 NL W + G GT + Y+L++ F + YP P+ F P HP++Y +G +CL Sbjct: 42 NLQKWTIDVTGAPGTLYANETYQLQVEFPEHYPMEAPQVVFVSPAPSHPHIYSNGHICLD 101 Query: 439 LLDEEKDWRPAITIKQILLGIQDLSMS 519 +L + W PA+T+ + + I + S Sbjct: 102 ILYD--SWSPAMTVNSVCISILSMLSS 126 >At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative similar to Ubiquitin-conjugating enzyme E2 (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Xenopus laevis} SP|P51669, {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 409 Score = 58.0 bits (134), Expect = 7e-09 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = +1 Query: 271 TWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLD- 447 T + I G + T + G++ L++ + YP PP F P++HPN+ SG +CL +L+ Sbjct: 46 TIDAQIEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNL 105 Query: 448 -EEKDWRPAITIKQILLGIQ 504 + W+P++ I +L ++ Sbjct: 106 PPKGAWQPSLNISTVLTSMR 125 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 56.4 bits (130), Expect = 2e-08 Identities = 41/111 (36%), Positives = 58/111 (52%), Gaps = 8/111 (7%) Frame = +1 Query: 211 PSLWFCREAYEESRCSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEP 390 P + F R AYE SR L I G +GTP+ GL+ + F D YPS+PP + Sbjct: 349 PEMIFVR-AYE-SRMDL----LRAVIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHS 402 Query: 391 P--LFHPNVYPSGTVCLSLL-----DEEKDWRP-AITIKQILLGIQDLSMS 519 +PN+Y G VCLSLL ++ + W P T+ Q+L+ IQ L ++ Sbjct: 403 GGLRINPNLYNCGKVCLSLLGTWSGNQREKWIPNTSTMLQVLVSIQGLILN 453 >At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family protein similar to ubiquitin-conjugating enzyme GB:3319990 from [Mus musculus]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1163 Score = 55.2 bits (127), Expect = 5e-08 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 8/97 (8%) Frame = +1 Query: 253 CSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPP--LFHPNVYPSGT 426 C + I G +GTP+ GL+ + F D YPS PPK + +PN+Y G Sbjct: 630 CESRIDLLRAVIIGAEGTPYHDGLFFFDIQFPDTYPSVPPKVHYHSGGLRINPNLYKCGK 689 Query: 427 VCLSLLD-----EEKDWRP-AITIKQILLGIQDLSMS 519 VCLSL+ + + W P T+ Q+L+ IQ L ++ Sbjct: 690 VCLSLISTWTGKKREKWLPKESTMLQLLVSIQALILN 726 Score = 54.4 bits (125), Expect = 9e-08 Identities = 35/104 (33%), Positives = 49/104 (47%), Gaps = 8/104 (7%) Frame = +1 Query: 232 EAYEESRCSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPP--LFHP 405 EA C + I G +GTP+ GL+ + F D YPS PP + +P Sbjct: 289 EAISVRACESRMDLLRAVIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVHYHSGGLRINP 348 Query: 406 NVYPSGTVCLSLL-----DEEKDWRP-AITIKQILLGIQDLSMS 519 N+Y G VCLSLL + W P T+ Q+L+ IQ L ++ Sbjct: 349 NLYNCGKVCLSLLGTWAGSAREKWLPNESTMLQLLVSIQALILN 392 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 253 CSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPP--LFHPNVYPSGT 426 C + I G +GTP+ GL+ + F D YPS PP + +PN+Y G Sbjct: 942 CESRMDLLRAVIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVYYHSGGLRINPNLYNCGK 1001 Query: 427 VCLSL 441 V +S+ Sbjct: 1002 VLVSI 1006 >At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 243 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 1/86 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 +++ W + G +GTP+ GG Y ++ F +YP PP P + +CLS+ Sbjct: 33 DILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITMTTP--NGRFVTQKKICLSM 90 Query: 442 LD-EEKDWRPAITIKQILLGIQDLSM 516 D + W P ++ IL G+ M Sbjct: 91 SDFHPESWNPMWSVSSILTGLLSFMM 116 >At2g18600.1 68415.m02166 RUB1-conjugating enzyme, putative strong similarity to gi:6635457 RUB1 conjugating enzyme [Arabidopsis thaliana]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 185 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/80 (31%), Positives = 42/80 (52%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 +LM +E I +G + G + + YP PK K + ++HPN+ G VCL++ Sbjct: 59 DLMNFEVTIKPDEGY-YLSGNFVFSFQVSNMYPHEAPKVKCKTKVYHPNIDLEGNVCLNI 117 Query: 442 LDEEKDWRPAITIKQILLGI 501 L E DW+P + I ++ G+ Sbjct: 118 LRE--DWKPVLNINTVIYGL 135 >At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 237 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 1/86 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 +++ W + G +GTP+ GG Y ++ F +YP PP P + +CLS+ Sbjct: 33 DILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITMTTP--NGRFMTQKKICLSM 90 Query: 442 LD-EEKDWRPAITIKQILLGIQDLSM 516 D + W P ++ IL G+ M Sbjct: 91 SDFHPESWNPMWSVSSILTGLLSFMM 116 >At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1102 Score = 49.6 bits (113), Expect = 3e-06 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 8/86 (9%) Frame = +1 Query: 286 IPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPP--LFHPNVYPSGTVCLSLLDE--- 450 I G GTP++ GL+ DYPS PP + +PN+Y G VCLSLL+ Sbjct: 886 IVGAFGTPYQDGLFFFDFHLPSDYPSVPPSAYYHSGGWRLNPNLYEEGKVCLSLLNTWTG 945 Query: 451 --EKDWRP-AITIKQILLGIQDLSMS 519 + W P + +I Q+L+ +Q L ++ Sbjct: 946 RGNEVWDPKSSSILQVLVSLQGLVLN 971 >At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E2; identical to gi:431269, SP:P42749 Length = 185 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +1 Query: 292 GKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLSLLDEEKDWRP 468 G K + +EGG++K+R+ D YP P F ++HPNV SG+VCL ++++ W P Sbjct: 38 GPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVINQ--TWSP 95 Query: 469 AITIKQI 489 + + Sbjct: 96 MFDLVNV 102 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +1 Query: 292 GKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSLLDEEKDWRP 468 G K + ++GG++K+R+ D YP P F ++HPNV SG+VCL ++++ W P Sbjct: 38 GPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSVCLDVINQ--TWSP 95 Query: 469 AITIKQI 489 + + Sbjct: 96 MFDLVNV 102 >At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 907 Score = 47.2 bits (107), Expect = 1e-05 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 8/97 (8%) Frame = +1 Query: 253 CSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEP--PLFHPNVYPSGT 426 C + A+ G GTP+ GL+ ++ YP PP + +PN+Y SG Sbjct: 687 CEERMDLLRAALVGAPGTPYHDGLFFFDIMLPPQYPHEPPMVHYHSGGMRLNPNLYESGR 746 Query: 427 VCLSLLDE-----EKDWRP-AITIKQILLGIQDLSMS 519 VCLSLL+ + W + +I Q+LL Q L ++ Sbjct: 747 VCLSLLNTWSGSGTEVWNAGSSSILQLLLSFQALVLN 783 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 1/86 (1%) Frame = +1 Query: 265 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSL 441 + +W I G T +EG +++L++ DYP SPP +F+ + V P +G V S Sbjct: 44 MQSWTGTILGPHNTAYEGKIFQLKLFCGKDYPESPPTVRFQSRINMACVNPENGVVDPSH 103 Query: 442 LDEEKDWRPAITIKQILLGIQDLSMS 519 +WR T++ +L+ ++ MS Sbjct: 104 FPMLSNWRREFTMEDLLIQLKKEMMS 129 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 1/86 (1%) Frame = +1 Query: 265 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSL 441 + +W I G T +EG +++L++ +YP SPP +F+ + V P +G V SL Sbjct: 44 MQSWTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPETGVVEPSL 103 Query: 442 LDEEKDWRPAITIKQILLGIQDLSMS 519 +WR T++ IL+ ++ M+ Sbjct: 104 FPMLTNWRREYTMEDILVKLKKEMMT 129 >At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative similar to Non-Canonical UBiquitin Conjugating Enzyme 1 (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus] GI:7363050, [Homo sapiens] GI:7362973; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 309 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Frame = +1 Query: 262 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 441 N+ W+ AI G T +EGG+Y R+ DYP PP P + + +CLS+ Sbjct: 39 NIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKPPSFMLLTP--NGRFETNTKICLSI 96 Query: 442 LD-EEKDWRPAITIKQILLGI 501 + + W+P+ +++ L+ + Sbjct: 97 SNYHPEHWQPSWSVRTALVAL 117 >At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E2; identical to gi|431267, SP:P42750, PIR:S52661; contains a ubiquitin-conjugating enzymes active site (PDOC00163) Length = 183 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +1 Query: 238 YEESRCSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-Y 414 Y+ + +L + G + ++GG++K+++ + YP P F ++HPNV Sbjct: 20 YKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDE 79 Query: 415 PSGTVCLSLLDEEKDWRP 468 SG VCL ++++ W P Sbjct: 80 SSGAVCLDVINQ--TWSP 95 >At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 37.9 bits (84), Expect = 0.008 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 2/101 (1%) Frame = +1 Query: 265 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLSL 441 + +W I G T EG +Y+L++ DYP PP +F + V + +G V Sbjct: 46 MRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKK 105 Query: 442 LDEEKDWRPAITIKQILLGI-QDLSMSLT*KIQRKLKPTQF 561 +W+ T++ IL+ + +++S S K+ + + T F Sbjct: 106 FGLLANWQREYTMEDILVQLKKEMSTSHNRKLVQPPEGTCF 146 >At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 145 Score = 37.5 bits (83), Expect = 0.011 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 265 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLSL 441 + +W I G T EG +Y+L++ DYP PP +F + V + +G V Sbjct: 45 MRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKK 104 Query: 442 LDEEKDWRPAITIKQIL 492 +W+ T++ IL Sbjct: 105 FGVLANWQRQYTMEDIL 121 >At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 147 Score = 33.5 bits (73), Expect = 0.18 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 3/102 (2%) Frame = +1 Query: 265 LMTWECAIPGKKG-TPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLS 438 + +W I G T EG +Y+L++ DYP PP +F + V + +G V Sbjct: 46 MRSWTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPK 105 Query: 439 LLDEEKDWRPAITIKQILLGI-QDLSMSLT*KIQRKLKPTQF 561 +W+ T++ IL+ + +++S S K+ + + T F Sbjct: 106 KFGLLANWQREYTMEDILVQLKKEMSTSHNRKLVQPPEGTCF 147 >At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 33.1 bits (72), Expect = 0.23 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +1 Query: 265 LMTWECAIPGKKG-TPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLS 438 + +W I G T EG +Y+L++ DYP PP +F + V + +G V Sbjct: 45 MRSWTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSK 104 Query: 439 LLDEEKDWRPAITIKQIL 492 +W+ T++ IL Sbjct: 105 KFGVLANWQRQYTMEDIL 122 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,996,904 Number of Sequences: 28952 Number of extensions: 389640 Number of successful extensions: 1009 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 986 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1921616800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -