BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40199 (792 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0772 + 24483314-24486781,24487148-24487240,24488366-24488458 28 7.4 04_04_1334 - 32723950-32724121,32724527-32724558,32724665-327247... 28 7.4 >06_03_0772 + 24483314-24486781,24487148-24487240,24488366-24488458 Length = 1217 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = +2 Query: 62 VAGDKFELSWQPSMKKISNVSVSEETLYTTLTANSPPTLVIAASESNTVGPAK 220 V DKF +KK+ V + +TL+ ++ +S ++ +++ P K Sbjct: 119 VGTDKFRRKLTDMLKKLDEVKTTADTLFKLVSFDSATAKLLPVTQARVTSPLK 171 >04_04_1334 - 32723950-32724121,32724527-32724558,32724665-32724708, 32724962-32725123,32725984-32726422 Length = 282 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 281 PYPEAMTYTLPCPKWWLNTL 340 PYP +YTLP WW L Sbjct: 64 PYPAPGSYTLPGSPWWAENL 83 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,244,971 Number of Sequences: 37544 Number of extensions: 395549 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -