BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40199 (792 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 24 6.2 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 8.2 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.8 bits (49), Expect = 6.2 Identities = 22/72 (30%), Positives = 31/72 (43%) Frame = +2 Query: 44 ARSLNPVAGDKFELSWQPSMKKISNVSVSEETLYTTLTANSPPTLVIAASESNTVGPAKS 223 A SL+PV+ KF+ S S SN SVS T AA+ + +V P + Sbjct: 87 ALSLSPVSVSKFDTS--ASTSNSSNASVSPVKSLNGSTKGLLLAAAAAAAVNQSVCPQTT 144 Query: 224 FALNILEKCQIF 259 EK ++F Sbjct: 145 LLPVTPEKPKLF 156 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 676 LNKLFRFRETGNLLLD 723 ++K+ FR+T NLLLD Sbjct: 302 MSKVLLFRKTANLLLD 317 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,425 Number of Sequences: 2352 Number of extensions: 15847 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -