BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40194 (831 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 25 1.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 25 1.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 25 1.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 25 1.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 1.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 25 1.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 25 1.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 25 1.1 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 2.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 24 2.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 2.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 2.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 2.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 2.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 2.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 2.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 2.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 2.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 2.0 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 2.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 2.0 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 2.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 2.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 2.0 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 2.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 2.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 2.0 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 2.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 2.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 2.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 2.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 2.0 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 8.0 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 725 IHRDRRSDHTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDLS 582 I ++R +H L ++ L + LRR K S + PE G + S Sbjct: 44 IQQEREREHERLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNAS 91 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 201 TSSNSLRSRTHGFQHTSSRYSRER 224 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 201 TSSNSLRSRTHGFQHTSSRYSRER 224 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSHYSRER 235 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSHYSRER 235 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSHYSRER 235 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSHYSRER 235 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 201 TSSNSLRSRTHGFQHTSSHYSRER 224 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSHYSRER 235 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 201 TSSNSLRNRTHGFQHTSSRYSRER 224 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRNRTHGFQHTSSRYSRER 235 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRNRTHGFQHTSSRYSRER 235 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 201 TSSNSLRNRTHGFQHTSSRYSRER 224 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRNRTHGFQHTSSRYSRER 235 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 201 TSSNSLRNRTHGFQHTSSRYSRER 224 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 217 TSSNSLRNRTHGFQHTSSRYSRER 240 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRNRTHGFQHTSSRYSRER 235 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRSRTHGFQHTSSRYSRER 235 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQ 204 TSSN + RTHG + +S RE+ Sbjct: 212 TSSNSLRNRTHGFQHTSSRYSRER 235 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 3.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 275 TSSNISKQRTHGDRSQTSPSGREQR 201 TSSN + RTH + +S RE+R Sbjct: 212 TSSNSLRNRTHDFQHTSSRYSRERR 236 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 8.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 701 HTPLIRRETLSHALRRFVLKNESDEPNGQIPEEWGPKDL 585 +TP++ T A + +K + D NG+ EE PK + Sbjct: 357 YTPVLDCHTAHIACKFADIKEKCDRRNGKTTEE-NPKSI 394 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,817 Number of Sequences: 438 Number of extensions: 5557 Number of successful extensions: 46 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -