BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40192 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 85 4e-19 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 24 1.1 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 24 1.1 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 85.4 bits (202), Expect = 4e-19 Identities = 39/79 (49%), Positives = 51/79 (64%) Frame = +3 Query: 255 NGISAQSSGSLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYTADENGYQPQSELLPVAPPM 434 NGIS Q SG K+VDN + QG Y+APDG V TY ADENG+Q Q +P APP+ Sbjct: 50 NGISHQESGQPKQVDNETPVVSQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAPPI 109 Query: 435 PEAIRRAIDYILAHPPKTE 491 P I+RA+++ AHP + + Sbjct: 110 PPEIQRALEWNAAHPEEDD 128 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 175 GSEADAVILRSDTEVNPDGFSFGYETEMESALNH 276 G++ DAVI EVN DG ++ E + ++H Sbjct: 22 GADKDAVITSQQLEVNFDG-NYINNFETSNGISH 54 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 430 GGATGSNSLCGWYPFSSA 377 GGA G+ SLC YP A Sbjct: 122 GGAAGATSLCFVYPLDFA 139 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 430 GGATGSNSLCGWYPFSSA 377 GGA G+ SLC YP A Sbjct: 122 GGAAGATSLCFVYPLDFA 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,495 Number of Sequences: 438 Number of extensions: 3611 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -