BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40192 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 4.6 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 4.6 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 28 6.1 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 321 QGQYEYSAPDGTPVKFTYTADENG---YQPQSELLPVAPPMPEA 443 QGQ YS+P P + + A NG + P S P+ PP P+A Sbjct: 78 QGQ-PYSSPAYPPHQPPFNAGANGNSQFPPPSTGAPIPPPYPQA 120 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 321 QGQYEYSAPDGTPVKFTYTADENG---YQPQSELLPVAPPMPEA 443 QGQ YS+P P + + A NG + P S P+ PP P+A Sbjct: 78 QGQ-PYSSPAYPPHQPPFNAGANGNSQFPPPSTGAPIPPPYPQA 120 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 381 DENGYQPQSELLPVAPPMPEAIRRAIDYILAHPPKTET 494 D+ GY P + + PV+PP P + ++ PP T T Sbjct: 68 DDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPT 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,637,758 Number of Sequences: 28952 Number of extensions: 238691 Number of successful extensions: 616 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -