BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40191 (851 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0384 + 18409831-18409843,18410378-18410471,18410614-184107... 30 2.0 06_02_0105 - 11893666-11895483,11895661-11896422 29 6.2 >12_02_0384 + 18409831-18409843,18410378-18410471,18410614-18410734, 18411635-18412543,18412772-18413211,18413481-18414516 Length = 870 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 254 PHRKQCFKALTNFCLTALKKGNFEKDLLIDV 346 PH K+CF +FC K FEKD L+D+ Sbjct: 405 PHLKRCF----SFCAVYPKDYRFEKDTLVDI 431 >06_02_0105 - 11893666-11895483,11895661-11896422 Length = 859 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/88 (21%), Positives = 38/88 (43%) Frame = +2 Query: 149 KSSCGIPALGIRIALRLPLVELREIDSGLGQSAPQPHRKQCFKALTNFCLTALKKGNFEK 328 +++ I A +R+ ++L L EL + A + + L K+ + K Sbjct: 559 EATSSIAAASLRVEIQLALRELEAVQ------AKEKESRNGMLGLQKIMEDTAKEADESK 612 Query: 329 DLLIDVQDKLQEMISDSDELHSCLKIVQ 412 + + Q+KL++ D D SCL ++ Sbjct: 613 SIAREAQEKLRKAKEDMDHAKSCLDTME 640 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,191,396 Number of Sequences: 37544 Number of extensions: 424099 Number of successful extensions: 905 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 905 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2373961368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -