BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40185 (807 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.01c |||conserved protein|Schizosaccharomyces pombe|chr 1... 28 1.4 SPBC19C7.10 |||transcription factor |Schizosaccharomyces pombe|c... 26 7.2 SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.6 >SPAC6G9.01c |||conserved protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 95 Score = 28.3 bits (60), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 387 SSEGVLVDDQTVQDLGRQTNIPHCNFQMHCC 295 + EG LV D+ ++G+ P C F CC Sbjct: 64 TEEGFLVYDEEELNIGQGGGTPDCPFDCQCC 94 >SPBC19C7.10 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 175 SIMSIPFYKMNSREEYEMNED 237 SI S P K SRE++E NED Sbjct: 366 SIRSSPKSKKRSREDFEENED 386 >SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 646 Score = 25.4 bits (53), Expect = 9.6 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -1 Query: 153 MNCFNLYNVITDFFQY*MSTLQFRSLNKN 67 +NC++L NV+ ++ L F+ +N+N Sbjct: 415 LNCYSLLNVLANYVVVFKDRLIFQEINQN 443 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,492,251 Number of Sequences: 5004 Number of extensions: 75265 Number of successful extensions: 183 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 392429240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -