BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40185 (807 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 28 0.39 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 25 2.1 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 25 2.1 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 25 2.1 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 3.6 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 24 6.3 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 8.4 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 27.9 bits (59), Expect = 0.39 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 503 SLHSVRSSHSRAIRTKSSSEWVLI 432 SLH VR+S + I +SSS W+++ Sbjct: 2 SLHFVRTSTTHGINMRSSSVWLIV 25 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 25.4 bits (53), Expect = 2.1 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -1 Query: 462 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 319 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 312 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 358 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 25.4 bits (53), Expect = 2.1 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -1 Query: 462 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 319 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 288 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 334 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 25.4 bits (53), Expect = 2.1 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -1 Query: 462 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 319 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 285 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 331 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 419 WAFTQSKPIRKRIWSG 466 W F Q+KP R R W+G Sbjct: 162 WQFPQTKPKRIRGWTG 177 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.8 bits (49), Expect = 6.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 613 IGLFWNVSFALPFKKSWRRI*ENGVSKSNDGGSNSEKRF 729 +GLF + F K+ + +G S S +G SNS+ F Sbjct: 80 LGLFARTMEHITFDKANDQTARDGSSSSKNGPSNSQASF 118 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 551 FSNCPL*VHNALNIFNSLHSVRSSHSRAIRTKSS 450 FSN PL +HN+ N+ +S SS + T S Sbjct: 534 FSNLPLSIHNSYAAPNNSNSSDSSSGISAMTAPS 567 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 862,758 Number of Sequences: 2352 Number of extensions: 17856 Number of successful extensions: 37 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -