BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40184 (849 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. 26 1.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.1 >AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. Length = 93 Score = 25.8 bits (54), Expect = 1.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 267 IPPGYAWANTLGIKNAKVYRISGFKKVDEYD 359 +P W N +KN +YR+ G + +++YD Sbjct: 31 LPIFLGWENM--VKNRLIYRVKGGEYINDYD 59 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 5.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 443 LHIVLFFTF*VLCICFNFIFSNHLP 369 L+ F VLCICF SN P Sbjct: 2840 LYQATFLALRVLCICFETRLSNEWP 2864 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,358 Number of Sequences: 2352 Number of extensions: 15880 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -