BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40184 (849 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119061-1|AAM50921.1| 114|Drosophila melanogaster LP07417p pro... 90 4e-18 AE014298-64|AAF45524.1| 114|Drosophila melanogaster CG13365-PA ... 90 4e-18 >AY119061-1|AAM50921.1| 114|Drosophila melanogaster LP07417p protein. Length = 114 Score = 89.8 bits (213), Expect = 4e-18 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = +1 Query: 73 KWWHAFVRKRTKPIPEDKAILWKRRLSFAYALFAWNAFGLVVYSAYKGKADWAHYYGIKS 252 KW +VR+ T PIPE +A LWKRRLS YA+ AW AFGLV Y Y G+ DWA YYG K+ Sbjct: 7 KWLRRWVRRNTNPIPEHRAELWKRRLSIGYAVLAWQAFGLVCYMVYTGRNDWAKYYGYKT 66 Query: 253 EKK 261 E++ Sbjct: 67 EEE 69 >AE014298-64|AAF45524.1| 114|Drosophila melanogaster CG13365-PA protein. Length = 114 Score = 89.8 bits (213), Expect = 4e-18 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = +1 Query: 73 KWWHAFVRKRTKPIPEDKAILWKRRLSFAYALFAWNAFGLVVYSAYKGKADWAHYYGIKS 252 KW +VR+ T PIPE +A LWKRRLS YA+ AW AFGLV Y Y G+ DWA YYG K+ Sbjct: 7 KWLRRWVRRNTNPIPEHRAELWKRRLSIGYAVLAWQAFGLVCYMVYTGRNDWAKYYGYKT 66 Query: 253 EKK 261 E++ Sbjct: 67 EEE 69 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,115,479 Number of Sequences: 53049 Number of extensions: 683571 Number of successful extensions: 1156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4065385896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -