BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40184 (849 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32920.1 68417.m04685 glycine-rich protein 29 5.2 >At4g32920.1 68417.m04685 glycine-rich protein Length = 1432 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 160 YALFAWNAFGLV-VYSAYKGKADWAHYYGIKSEKKNPYLQ 276 YAL WN LV V A+ + HY+G S KK PYLQ Sbjct: 1343 YAL--WNVTSLVNVVVAFV--CGYVHYHGSSSGKKIPYLQ 1378 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,017,386 Number of Sequences: 28952 Number of extensions: 346101 Number of successful extensions: 685 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -