BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40180 (735 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharo... 27 2.8 SPBP8B7.04 |mug45||sequence orphan|Schizosaccharomyces pombe|chr... 26 6.4 >SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 488 YLFMNLTYKYRLTSKYLAFLIWSSHYNELNSIYYNYNSFTK 366 Y F N++YK +L++KY+ F + + IY + FT+ Sbjct: 303 YAFFNMSYKAKLSTKYV-FRVLAQLSENFIFIYLGMSLFTQ 342 >SPBP8B7.04 |mug45||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 819 Score = 25.8 bits (54), Expect = 6.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 462 ISLNVKISRIPYLVLTLQRAEFYILQLQFIY 370 + LNV +S +LTL + ILQ+ FIY Sbjct: 787 VILNVNVSTTAMCLLTLLIGIYLILQVVFIY 817 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,884,814 Number of Sequences: 5004 Number of extensions: 59114 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -