BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40180 (735 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070778-1|AAL48400.1| 143|Drosophila melanogaster AT04637p pro... 29 8.7 AE014296-1827|AAF50151.1| 196|Drosophila melanogaster CG14151-P... 29 8.7 >AY070778-1|AAL48400.1| 143|Drosophila melanogaster AT04637p protein. Length = 143 Score = 28.7 bits (61), Expect = 8.7 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -1 Query: 492 FLFIYELNL*ISLN---VKISRIPYLVLTLQRAEFYILQLQFI 373 F+ +Y L L IS+N VKI+ +P++ L ++ YI+ L ++ Sbjct: 35 FILLYGLTLAISVNWEGVKITVLPFVGLAVEMTFVYIIYLLYL 77 >AE014296-1827|AAF50151.1| 196|Drosophila melanogaster CG14151-PA protein. Length = 196 Score = 28.7 bits (61), Expect = 8.7 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = -1 Query: 492 FLFIYELNL*ISLN---VKISRIPYLVLTLQRAEFYILQLQFI 373 F+ +Y L L IS+N VKI+ +P++ L ++ YI+ L ++ Sbjct: 88 FILLYGLTLAISVNWEGVKITVLPFVGLAVEMTFVYIIYLLYL 130 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,132,446 Number of Sequences: 53049 Number of extensions: 520065 Number of successful extensions: 915 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3314233461 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -