BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40180 (735 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49890.1 68418.m06178 chloride channel protein (CLC-c) identi... 28 5.6 At3g62010.1 68416.m06964 expressed protein 27 9.8 >At5g49890.1 68418.m06178 chloride channel protein (CLC-c) identical to gi:1742956 Length = 779 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 452 TSKYLAFLIWSSHYNELNSIYYNYNSFTKKKRFTTR 345 +S Y +F +HYN+L+S+ N N + FT+R Sbjct: 421 SSIYKSFQCPPNHYNDLSSLLLNTNDDAIRNLFTSR 456 >At3g62010.1 68416.m06964 expressed protein Length = 1254 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -2 Query: 506 SLERSFYLFMNLTYKYRLTSKYLAFLIWSSHYNELNSIYYN 384 +L R FYL +Y Y + + + FL W EL + +N Sbjct: 1209 ALRRYFYLITFRSYLYSTSPEEMKFLDWMKSRPELGHLCHN 1249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,941,029 Number of Sequences: 28952 Number of extensions: 264314 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -