Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40178
         (829 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g31670.1 68415.m03866 expressed protein similar to NADH-ubiqu...    28   8.7  

>At2g31670.1 68415.m03866 expressed protein similar to
           NADH-ubiquinone oxidoreductase B16.6 subunit (EC
           1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6)
           (Gene associated with retinoic-interferon-induced
           mortality 19 protein) (GRIM-19) (Cell death-regulatory
           protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus]
          Length = 263

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 4/51 (7%)
 Frame = -3

Query: 512 VRILISKPIAKTIPSTTHGSIN---HDRRLF-IATIRSVQIKMVKHKFIVK 372
           +R LIS P+A TI +T H  IN     RR F + +  + Q ++++H  + K
Sbjct: 6   IRPLISSPLAFTISTTKHSRINLRLLPRRSFSVMSSSTPQSQIIEHIVLFK 56


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,713,800
Number of Sequences: 28952
Number of extensions: 326910
Number of successful extensions: 696
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 679
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 696
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1902108000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)