BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40177 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38113| Best HMM Match : HORMA (HMM E-Value=0) 50 2e-06 SB_38321| Best HMM Match : ZZ (HMM E-Value=8.1e-09) 30 1.5 >SB_38113| Best HMM Match : HORMA (HMM E-Value=0) Length = 345 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +1 Query: 148 QIPKHERKVKIDKRFQPMFDDEKFKVKYTVDKRG 249 +IP+ +RKVKID RF+ MF D+ F KY VDKRG Sbjct: 289 KIPRKQRKVKIDSRFERMFTDKSFTTKYFVDKRG 322 >SB_38321| Best HMM Match : ZZ (HMM E-Value=8.1e-09) Length = 584 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 372 STDDESIDKIDPKTLNDKLTRGKLDKKIK 458 ST+DE I T +K+T GKL++K+K Sbjct: 210 STEDEPKSSIKSDTSKEKVTEGKLEEKLK 238 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,514,452 Number of Sequences: 59808 Number of extensions: 306430 Number of successful extensions: 695 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -