BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40176 (736 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 7.4 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 7.4 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 23 9.8 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 9.8 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 67 YNIYTAITHIHREKKLFNFAAPFNTRYFP 153 YN + R K+L N P + YFP Sbjct: 244 YNFERFSNRLQRVKRLNNLREPISEGYFP 272 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 67 YNIYTAITHIHREKKLFNFAAPFNTRYFP 153 YN + R K+L N P + YFP Sbjct: 244 YNFERFSNRLQRVKRLNNLREPISEGYFP 272 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 578 QNVIIVLKKMYRVKNMKSCHVSVANTLMSLEEI 676 QNV++V KK+ N+K ++ A + L ++ Sbjct: 13 QNVLLVAKKLGIALNIKKTNIMDATDVAELTKV 45 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 602 KMYRVKNMKSCHVSVANTLMSLEEILTNSPTSSIN 706 KM R N +S ANT + + + N T S+N Sbjct: 273 KMIRSSNNRSYPARAANTTLQDVDRVDNGTTVSVN 307 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,889 Number of Sequences: 2352 Number of extensions: 7592 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -