BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40176 (736 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78416-8|CAB01683.2| 588|Caenorhabditis elegans Hypothetical pr... 30 1.5 Z69717-4|CAA93533.2| 588|Caenorhabditis elegans Hypothetical pr... 30 1.5 AF040645-6|AAB94976.1| 301|Caenorhabditis elegans Hypothetical ... 29 4.5 >Z78416-8|CAB01683.2| 588|Caenorhabditis elegans Hypothetical protein E01G6.3 protein. Length = 588 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 577 AERNYCFKKNV*GKKYEVVSCFRRK 651 AER C+K+NV + E+V C R+K Sbjct: 256 AERVGCYKRNVTARDTEIVKCLRKK 280 >Z69717-4|CAA93533.2| 588|Caenorhabditis elegans Hypothetical protein E01G6.3 protein. Length = 588 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 577 AERNYCFKKNV*GKKYEVVSCFRRK 651 AER C+K+NV + E+V C R+K Sbjct: 256 AERVGCYKRNVTARDTEIVKCLRKK 280 >AF040645-6|AAB94976.1| 301|Caenorhabditis elegans Hypothetical protein F52C6.10 protein. Length = 301 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +2 Query: 596 LKKMYRVKNMKSCHVSVANTLMSLEEILTNSPT 694 + K Y+++N+K+ +S NT+ ++ +T PT Sbjct: 251 IAKQYKMENLKNSCLSKVNTVRDIKAAMTGDPT 283 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,737,689 Number of Sequences: 27780 Number of extensions: 186199 Number of successful extensions: 433 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -