BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40175 (703 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0270 + 19009412-19009888,19009936-19011048,19011810-190118... 29 4.7 >06_03_0270 + 19009412-19009888,19009936-19011048,19011810-19011899, 19011928-19012027,19012135-19012333,19012559-19012679 Length = 699 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +1 Query: 169 CFVLL-HEKIMFNKVFWAKLQFEIKSKHLLAS 261 C L+ H+K+ F+K++ QFEI+ K+L A+ Sbjct: 411 CLKLIPHKKLTFSKMWLMAAQFEIRQKNLKAA 442 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,508,229 Number of Sequences: 37544 Number of extensions: 204650 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -