BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40175 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 28 8.4 SB_59220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 1458 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -3 Query: 254 SKCLLFISNCNFAQKTLLNIIFSCNKTKQRNSSLFW 147 ++ + S C +A+ T + FSC +R +++ W Sbjct: 1367 TRMIALTSKCYYAEDTAMKAKFSCKGVSKRQNNMSW 1402 >SB_59220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 59 EEDVLPAL*IINNKDRQYYHKT 124 EE LP L +I+N D+ Y+H T Sbjct: 43 EESKLPKLTVIDNSDQVYFHDT 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,007,835 Number of Sequences: 59808 Number of extensions: 286421 Number of successful extensions: 567 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -