BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40175 (703 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z30423-5|CAA83008.1| 60|Caenorhabditis elegans Hypothetical pr... 29 3.2 Z81531-6|CAB04317.2| 330|Caenorhabditis elegans Hypothetical pr... 29 4.3 U64857-3|AAM29666.1| 1487|Caenorhabditis elegans Hypothetical pr... 27 9.8 U64857-2|AAC25867.1| 1558|Caenorhabditis elegans Hypothetical pr... 27 9.8 U64857-1|AAC25868.1| 2167|Caenorhabditis elegans Hypothetical pr... 27 9.8 >Z30423-5|CAA83008.1| 60|Caenorhabditis elegans Hypothetical protein T20G5.7 protein. Length = 60 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = -1 Query: 142 LKKVAMSFMIVLSVFVIYYS 83 LK VA+ F++++SVFV+Y S Sbjct: 4 LKTVALYFLVIMSVFVVYTS 23 >Z81531-6|CAB04317.2| 330|Caenorhabditis elegans Hypothetical protein F36D3.6 protein. Length = 330 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -3 Query: 182 NKTKQRNSSLFWLFEKSCDEFYDSIVCLCYLLFIRLAAHPLRVVYKL 42 N +K + S L F +FY +I+C+ ++++ +A +PL V+ L Sbjct: 44 NMSKVKFSMLVMHFTIFWIDFYWNILCIPFVIYAAVAGYPLGVIVYL 90 >U64857-3|AAM29666.1| 1487|Caenorhabditis elegans Hypothetical protein C37C3.6c protein. Length = 1487 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 483 KYSYYYANNGSTWCILMLYGNRTSRGNR 400 K+SYYY N S C YG NR Sbjct: 1445 KHSYYYYNTASHQCETFTYGGCLGNTNR 1472 >U64857-2|AAC25867.1| 1558|Caenorhabditis elegans Hypothetical protein C37C3.6a protein. Length = 1558 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 483 KYSYYYANNGSTWCILMLYGNRTSRGNR 400 K+SYYY N S C YG NR Sbjct: 1516 KHSYYYYNTASHQCETFTYGGCLGNTNR 1543 >U64857-1|AAC25868.1| 2167|Caenorhabditis elegans Hypothetical protein C37C3.6b protein. Length = 2167 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 483 KYSYYYANNGSTWCILMLYGNRTSRGNR 400 K+SYYY N S C YG NR Sbjct: 1516 KHSYYYYNTASHQCETFTYGGCLGNTNR 1543 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,313,930 Number of Sequences: 27780 Number of extensions: 239471 Number of successful extensions: 534 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -