BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40172 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 6.2 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 23 8.1 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.8 bits (49), Expect = 6.2 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +1 Query: 619 PKYYADGEDAYSMMR 663 P Y ADG+D ++M++ Sbjct: 499 PSYLADGKDGFAMLK 513 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -2 Query: 160 GGVSDIPPSSSRTNRNLDKQHFQTMYQLQNLINW 59 GG +D PP R R+ K Q + L+++ Sbjct: 38 GGATDTPPGVDRLQRSSQKFALQFYQYVTELVDY 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,520 Number of Sequences: 2352 Number of extensions: 15024 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -